المساعد الشخصي الرقمي

مشاهدة النسخة كاملة : ثورة الحمير


الصفحات : 1 2 3 [4] 5

اسماعيل الناطور
01-24-2012, 12:14 PM
و يقوم المخطط على توجيه الدعوات للمشاركة في مظاهرات سلمية يوم 25 يناير ثم الدعوة لاعتصامات تتحول إلى مناوشات واستفزاز واحتكاك مع الشرطة ثم مع عناصر من القوات المسلحة, كذلك يمكن الفهم إن المخطط يقوم على استدراج الشباب الطاهر والخاسرين في الانتخابات البرلمانية، بالإضافة إلى من تم التغرير بهم تحت وطئ الحياة أو قلة الوعي أو المطالب الفئوية وهناك إحتمال بدأ هذه التحركات المخططة سلفا من الليلة الثلاثاء مساء

بيان الفوضى رقم 1( بيان التحرريين )
الخطة التفصيلية في 25 يناير
*اماكن التجمع
1- ميدان مصطفى محمود
للتواصل(01226302477 / 01276521638)
امبابه التجمع الساعه 12 امام كنيسة الوحده بشارع الوحده بجوار كشري الاستاذ

2- جامع الاستقامه بميدان الجيزه
(للتواصل 01002573525\01226988627)

*العمرانيه التجمع امام جامع خاتم المرسلين بشارع خاتم المرسلين الساعه 11 صباحا
*فيصل التجمع بمحطة الطالبيه فيصل الساعه 11 صباحا
*الهرم التجمع امام جامع السلام الساعه 11 صباحا
*المنيب وساقية مكي مكان التجمع ميدان محطة مترو المنيب الساعه 11 صباحا
(على ان تتقابل المسيرات السابقه في ميدان الجيزه الساعه الواحده والنصف ظهرا وتتجه لجامعة القاهره حيث تنضم لها مسيرة طلبة الثانويه السعيديه وجامعه القاهره وكلية هندسه القاهره وتتجه اخيرا الى كوبري الجلاء حيث تصل هناك في تمام الرابعه عصرا )
3- ميدان السيده زينب
* منيل الروضه - مكان التجمع ميدان الباشا بالمنيل الساعه 11 صباحا
* مصر القديمه التجمع امام جامع عمرو ابن العاص الساعه 11 صباحا
* المعادي التجمع امام مسجد الفتح ش 9 بالمعادي الساعه 10 صباحا
(تتجمع المسيرات بميدان السيده زينب الساعه 2 وتتجه الى ميدان التحرير مباشره)
4- دوران شبرا
للتواصل(01003090406 / 01063368758)
ويشارك فيها اهالي شبرا والشرابيه والزاويه الحمرا ويكون التجمع الساعه 2 ظهرا في دوران شبرا وتتجه الى كوبري قصر النيل حيث تصل في تمام الساعه الرابعه
5- جامع الفتح برمسيس
6- مسيرة شرق القاهره
للتواصل(01115886609)
وتضم اهالي المطريه وعين شمس ومصر الجديده ومدينة نصر والزتون وحدايق القبه والعباسيه ويكون التجمع امام مترو غمره تحت الكوبري الساعه 2 ضهرا ومن ثم التوجه الى كوبري قصر النيل حيث تصل هناك في تمام الساعه الرابعه
تصل المسيرات في تمام الرابعه الى كوبري الجلاء (مصطفى محمود – الجيزه – شبرا )
كوبري قصر النيل (جامع الفتح – شرق القاهره)
حيث يقام
1- وقفة حداد على ارواح شهداء الثوره
2- قسم الحفاظ على الثوره وتحقيق اهدافها
3- واخير التوجه لميدان التحرير مباشرة
• ملحوظه يأتي على رأس كل مسيره رايه معلق بها علم مصر و صورة الشهيد واسمه
• (مسيرة مينا دانيال (شبرا)
• مسيرة علاء عبد الهادي (الجيزه)
• مسيرة عماد عفت( مصطفى محمود)
• مسيرة سيد بلال (مسجد الفتح )
• مسيرة خالد سعيد (السيده زينب)

*مسيرات اخرى
1- مسيرة اطباء عين شمس بالزي الطبي للمطالبه بالقصاص للشهيد علاء عبد الهادي متزامن مع ذكرى الاربعين لاستشهاده تبدأ الساعه 10 صباحا من امام جامع النور بالعباسيه الى ميدان التحرير
2- مسيرة كلية طب القاهره بالقصر العيني الساعه 11 صباحا بالزي الطبي من كلية طب القصر العيني الى ميدان التحرير
3- مسيرة كلية فنون جميله بالزمالك التجمع الساعه 10 صباحا امام كية فنون جميله بالزمالك تتجه من امام الكليه الى شارع شجرة الدر الى مسرح الزمالك الى شارع 26 يوليو الى فندق الماريوط الى شارع سرايا الجزيره الى كوبري قصر النيل
4- مسيرة شبرا الخيمه الساعه 11 صباحا من كوبري عرابي متجهه الى دوران شبرا ثم الى التحرير
5- مسيرة ميدان الحجاز مصر الجديده الساعه 12 ونصف ضهراالى ميدان التحرير
6 مسيرة جامع الازهر عقب صلاة الفجر متجهه الى ميدان التحرير
** ملحوظات
كل حد حد يقدر يطبع صورة شهيد او بانر شهيد او لمجموعه من الشهداء ويتحرك بها في المسيره الخاصه به
كل الي يقدر يطبع تي شيرت عليه صورة شهيد يلبسه وينزل بيه
1- اللجان الشعبية للدفاع عن الثورة
2- إئتلاف ثورة اللوتس
3- حركة شباب من أجل العدالة والحرية
4- إئتلاف شباب الثورة
5- حركة 6 ابريل
6- الجبهة القومية للعدالة والديمقراطية
7- الإشتراكيون الثوريون
8- الحركة الشعبية لدعم الأزهر
9- حركة المصرى الحر
10- تيار الإسلام العام
11- جبهة الإرادة الشعبية
12- الإئتلاف الإسلامى الحر
13- جمعية أطباء التحرير
14- اللجان الثورية الشعبية
15- حملة كاذبون
16- اتحاد شباب الثورة
17- تحالف حركات توعية مصر
18- اتحاد شباب ماسبيرو
19- الجبهة الحرة للتغيير السلمى
20- رابطة الشباب التقدمى
21- تكتل شباب بورسعيد
22- حزب العمال والفلاحين
23- جبهة عيش حريه عدالة إجتماعية
24- حركة شايفنكم
25- حملة دعم البرادعى "سابقاً" ومطالب التغيير
26- حزب الوعى
27- حزب مصر الحرية
28- حزب العدل
29- الحزب المصرى الديمقراطى الإجتماعى
30- حزب التحالف الشعبى الإشتراكى
31- حركة الإرادة الشعبية لمصر
32- حركة صحوة
33- حركة ثوار سيناء
34- التوافق الشعبى
35- جبهة الشباب الحر
36- حركة مصر بكرة
37- حركة العباسية مش تكية
38- شباب الوحدة الوطنية (عابدين والموسكى)
39- حركة كلنا مينا دانيال
40- شباب الجمعية الوطنية للتغيير
41- حركة مشاركة
42- شباب ثورة فجر
43- إئتلاف الثقافة الحر
44- حركة مصر المتنورة
45- الجبهة الثورية بدمياط
46- إئتلاف الثورة الديمقراطي بقنا
47- إئتلاف ثورة 25 يناير بالصعيد
48- إئتلاف ثورة 25 يناير بالأقصر
49- إئتلاف الثورة الديمقراطي بأسوان
50- حركة الديمقراطية الشعبية سوهاج
51- إئتلاف شباب سوهاج
52- حركة الديمقراطيه الشعبيه المصريه بأسيوط
53- إئتلاف شباب أسيوط
54- تكتل شباب السويس
55- حركة الثوار المستقلين بقن
56- حزب الحياة
57- تحالف القوى الثورية
58- حركة ثورة الغضب المصرية الثانية
59 - كل شعب وثوار مصر

اسماعيل الناطور
01-24-2012, 12:19 PM
بيان الفوضى رقم 2 ( الإسلام السياسي )
http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/396471_329846593722335_197799773593685_1009207_804 288812_n.jpg

اسماعيل الناطور
01-24-2012, 12:38 PM
لماذا هي بيانات للفوضى وليس للفرحة ؟
عندما تدقق في البيانين تجد أن الكل متفق على إنه هناك نية للتخريب وبدلا أن يكون القرار الوطني بحصر الاحتفال في مكان واحد والابتعاد عن أي بؤرة حساسة وترك الأمر للشرطة والجيش لحمايتها ولكشف العناصر المخربة , تجد هذه الدعوة للتظاهر في كل شبر وشارع بدعوى محاربة التخريب رغم أن هذه الطريقة هي في حقيقتها منح الفرصة المثالية للتخريب , لذلك أقول ومهما كانت النيات فهذه البيانات والتحركات هي عناصر مهمة لتوفير الجو الملائم لمخطط الفوضى .....
فهل سيتكرر في مصر نموذج ( ظهور القوة التنفيذية لحركة حماس بدلا من الشرطة الفلسطينية والجيش الفلسطيني) ؟
بمعنى أن بحجة الدفاع عن الوطن كما ورد في البيان ستظهر القوة التنفيذية للأحزاب
على الشرفاء في مصر أن يصروا على الاحتفال في مكان واحد فقط
وعلى الشرفاء في مصر توجيه الدعوة للشرطة والجيش لحماية البلاد والعباد
وغدا يوم فاصل في تاريخ مصر

اسماعيل الناطور
01-24-2012, 12:51 PM
بيان 3 الكثلة الصامتة
http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/402137_307861205918056_181163758587802_750416_2049 702814_n.jpg

اسماعيل الناطور
01-25-2012, 08:58 AM
أعتقد....
لقد فاتهم القطار أخي محمد برجيس
عندما أطلقنا هذه المشاركة كنت أضعها لعدة أعتبارات
فما الفرق بين مؤثرات 25 يناير 2011 ومؤثرات 25 يناير 2012 ؟
كانت هناك مؤامرة منظمة إستغلت مشاعر شعب يريد حقا ثورة وإستغلت رجال حكم أغراهم الجهل والوعي إنهم وبخدمتهم لأمريكا وإسرائيل حموا أنفسهم , فكان ما كان من إنهيار سريع لكل مغرور وفاسد .....أما اليوم فالمؤامرة تواجه شعبا يحب وطنه وأمنه وإستقراره وتزايد وعيه وأحب ثورته وأصبح له نظرة ورأي في كل الوجوه , فلن يستغله أحد كما سبق , ورجال الحكم الحاليين واثقين من أنفسهم , ومن نظافتهم ومن حبهم لوطنهم ومعلوماتهم عن المؤامرة متوفرة
لذلك لن ينهاروا سريعا كما إنهار مبارك وحاشيته الفاسدة , فرجال المجلس العسكري والجيش لن يأخذه أو يخفيه أحدهم بحملات الاعلام ومدونات الفيس بوك, فلقد ذهب هذا الزمن إلى غير رجعة , وأما رجال الشرطة اليوم , فهم أيضا ليس في حال الفوضى والقهر والفسادالماضي ,والذي أدى إلى إنهيار قيادتها الفاسدة في دقائق , هم اليوم يعلمون أن لشرف الشرطة ثمن ومقدار مسئولياتها وأهميتها في خدمة الشعب , لذلك كان الأمر اليوم بالتصدي بالرصاص الحي لكل من تسوله نفسه بمهاجمة مقار أو مراكز الشرطة , اليوم يوما آخر فلا المتظاهر هو نفسه ولا الجيش هو نفسه ولا الشرطة هي نفسها ولا مزاج الشعب هو نفسه ,,,
الكل أصبح يقول:
لا للفوضى لا للتقسيم لا للحرق لا للتخريب
لا للمؤامرة وأذنابها لا لقوقل والفيس بوك وأدوات الانتفاضة الماسونية الحقيرة ....
.اليوم يوما آخر ...
فعلا لقد فاتكم القطار ...وسيذهب البرادعي وما يمثل من وجوه ماسونية حقيرة إلى مزابل العرب ....
اليوم في مصر رجال حكم واثقين من أنفسهم, ولعل ظهور الطنطاوي أمس وإلغاء قانون الطوارئ كمن يقول لهم ...
يا أيها التافهين القيادة عندما تريد شيئا لمصلحة شعبها ,فإنها تفعله بدون قانون طوارئ ...
لقد فاتكم القطار بعد أن إسترد الشعب وعيه , وركب الحمير في مسيرته نحن الثورة الشعبية النظيفة , فشكرا لكم حمير الماسونية ...وأتعشم أن أقول لكم بعد أيام .... إنتهى الدرس يا أغبياء

اسماعيل الناطور
01-25-2012, 09:33 AM
http://www.youtube.com/watch?v=u5dwJwq9SI4
وزير الداخلية يحذر من إرتداء الملابس العسكرية
أما هذه المذيعة ومن قناة التحرير قناة البرادعي وابراهيم عيسى فإسمعها وتأكد من حملات التشويه

اسماعيل الناطور
01-25-2012, 11:58 AM
حسب الخطة الأمنية
1-منذ ساعات الصباح الجيش العربي المصري يبتعد عن الوظيفة الأمنية ويسلمها كاملة لوزارة الداخلية واللجان الشعبية من شباب أصدقاء الشرطة
بينما يترك الميادين مثل ميدان الأربعين في السويس وميدان التحرير بالقاهرة تحت الحماية الكاملة للمتظاهرين

اسماعيل الناطور
01-25-2012, 12:17 PM
حسب الخطة الأمنية
1-منذ ساعات الصباح الجيش العربي المصري يبتعد عن الوظيفة الأمنية ويسلمها كاملة لوزارة الداخلية واللجان الشعبية من شباب أصدقاء الشرطة
بينما يترك الميادين مثل ميدان الأربعين في السويس وميدان التحرير بالقاهرة تحت الحماية الكاملة للمتظاهرين

2-بيان يقول أن الجيش والشرطة لا تتواجد في الميادين المذكورة وكل من يتواجد بالزي الرسمي فليس هو من الجيش والشرطة وعليه مسموح القبض عليه وتسليمه إلى الجهات المختصة

اسماعيل الناطور
01-26-2012, 12:14 AM
إنتهى الإحتفال الرائع للشعب المصري .....
ولكن ...هل بدأ سيناريو تحرك أصابع الفتنة ...
اولا - المطالبة بترك المجلس العسكري للحكم والعودة لمطلب رئيس مدني من الميدان وأعتقد إنه أحد الوجوه المتشابهه غرضا ووظيفة ( البرادعي - الغزالي حرب - ابو الفتوح ) .....
ثانيا - العودة للإعتصامات والثورة المستمرة لخلق حالة إحتكاك ....
ثالثا - الذهاب إلى ماسبيرو ومبنى التليفزيون الحكومي تمهيدا لخلق إحتكاك مع قوات الأمن هناك
رابعا- إعلان الأخوان بقاءهم في الميدان لغرض الحماية وضع تحت الحماية خطا
خامسا- إحتمال سنعود إليه فور تحققه لا سمح الله
وغدا لناظره قريب
وأعتقد أن المجلس العسكري باق مهما فعلوا ...فالطبخة فاشلة ومعلومة ومحسوب حسابها

اسماعيل الناطور
01-26-2012, 01:23 AM
إنتهى الإحتفال الرائع للشعب المصري .....
ولكن ...هل بدأ سيناريو تحرك أصابع الفتنة ...
اولا - المطالبة بترك المجلس العسكري للحكم والعودة لمطلب رئيس مدني من الميدان وأعتقد إنه أحد الوجوه المتشابهه غرضا ووظيفة ( البرادعي - الغزالي حرب - ابو الفتوح ) .....
ثانيا - العودة للإعتصامات والثورة المستمرة لخلق حالة إحتكاك ....
ثالثا - الذهاب إلى ماسبيرو ومبنى التليفزيون الحكومي تمهيدا لخلق إحتكاك مع قوات الأمن هناك
رابعا- إعلان الأخوان بقاءهم في الميدان لغرض الحماية وضع تحت الحماية خطا
خامسا- إحتمال سنعود إليه فور تحققه لا سمح الله
وغدا لناظره قريب
وأعتقد أن المجلس العسكري باق مهما فعلوا ...فالطبخة فاشلة ومعلومة ومحسوب حسابها
مراسلة قناة المحور تقول أن الشاذ علاء عبد الفتاح ونوارة نجم والفنانة جيهان فضل هم من يقودوا التوجه إلى ماسبيرو

اسماعيل الناطور
01-26-2012, 10:57 AM
لماذا شعار يسقط يسقط حكم العسكر ؟
لماذا يجب تشويه جيش مصر العربي ؟
إنه الفوضى والتقسيم
"أنصار الجهاد في جزيرة سيناء" تبايع زعيم القاعدة
نشر 25 كانون الثاني/يناير 2012 - 09:07 بتوقيت جرينتش
بايع تنظيم "انصار الجهاد في جزيرة سيناء" زعيم تنظيم القاعدة ايمن الظواهري، حسب ما اعلن الثلاثاء مركز اميركي لمراقبة المواقع الاسلامية "سايت".
وكان "انصار الجهاد في جزيرة سيناء" اعلن عن نفسه في كانون الاول/ ديسمبر.
وجاء في رسالة موجهة الى ايمن الظواهري ونشرت على الانترنت
"الى اميرنا الحبيب وشيخنا المفضال، ابي محمد ايمن الظواهري حفظك الله ونصرك واعانك، من جنودك في سيناء الحبيبه في ارض الكنانه نبايعك على السمع والطاعة في المنشط والمكره والعسر واليسر واثره علينا".
واضاف البيان "ارم بنا حيث شئت فلن ترى ولن تسمع منا الا ما تقر بها عينك وتشفي بها صدرك فلن نقر ولن نستسلم الا على اخر قطرة من دمنا في سبيل الله وحتى يحكم الاسلام بعون الله تعالى".
وفي 21 كانون الاول/ديسمبر، اعلن موقع سايت ان التنظيم الجديد وعد بشن هجمات على المجلس العسكري الذي يدير شؤون الحكم في القاهرة وعلى اهداف اميركية.
يشار الى انه بين 2004 و2006 تعرضت فنادق في سيناء لاعتداءات اوقعت اكثر من مئة قتيل. واشارت اصابع الاتهام الى تنظيم التوحيد والجهاد.
وقد اشاد هذا التنظيم بالهجمات التي وقعت في اب/ اغسطس الماضي واودت بحياة ثمانية اسرائيليين في منطقة ايلات ولكن دون ان يتبناها، حسب سايت.

اسماعيل الناطور
01-26-2012, 11:44 AM
ما أهمية هذا الخبر ؟
لإنه خبر يتوافق مع ما يكتب عن التفكير في سلخ سيناء عن مصر كدولة مستقلة تعفي إسرائيل من مواجهتها لشعب مصر وكتله البشرية شرق قناة السويس ؟
والسيناريو ...
1-أن تضعف الجيش المصري بفرض سلطة مدنية غير منتخبة تؤدي إلى خلق فوضى لتحجيم دور الجيش في القيادة عن طريق فرض قيادات وميزانيات تعمل على تفكيك تماسك المؤسسة العسكرية
2-أن تخلق فوضى وعدم سيطرة في سيناء مستغلة فكرة الجهاد ضد إسرائيل في وقت أن المجاهدين لا يملكون من القوة الحقيقية التي تؤهلهم مجاراة إسرائيل وجيشها والقوى العالمية التي تعمل خلفها , وبذلك تعطي الحق القانوني لإسرائيل بإعادة صياغة الأمن في إسرائيل وإلغاء المعاهدة في وقت ضعف ومن منطق المحافظة على أمنها القومي , تماما كما حدث في غزة ومنذ سيطرة حماس لدرجة أن الطائرات الاسرائيلية تضرب غزة في أي وقت تشاء وتقتل من تشاء بحجة أن نظام حماس إرهابي ويهدد أمن إسرائيل دون أي رد فعل دولي أو محلي

اسماعيل الناطور
01-26-2012, 12:50 PM
1499
في فيلم و إسلاماه
ظل ( حسين رياض) يردد طوال الفيلم ( إحذروا التتار )
و يتهمه الناس بالجنون كلما حكى لهم عن ( التتار )
و يطلبون منه إكمال قصة ( محمود و جهاد )

و بنهاية الفيلم إكتشف الجميع بما فيهم المشاهد
أنه كان البطل الحقيقي للفيلم بعد ظهور التتار مرة أخرى
بعدما إعتبروه مجرد كمبرس في البداية !
( ليتهم يفهمون الان )

ذكرني الأمر بموضوع يخلق من الشبه أربعين
راجع من كان له شبه حسين رياض ؟

شكرا لتذكيري في هذا الموضوع الهادف , وعندما عدت له وجدت هذه المشاركة , وكانت ردا على ما تفضلت , وحيث إنني أجدها تناسب ما نحن فيه , سأعيد وضعها هنا , فالعبرة دائما بالفكرة والهدف منها وخدمة القارئ



الأخ محمد برجيس
قد تتآخى القلوب
ولكن هنا
توافقت العقول
فأنت تفكر بي
وأنا أفكر بك
فوالله لو خرجنا من هذا الملتقى بكهذا معاني للحياة
لحمدت الله أن وقتنا ما ضاع سدى
*******
الأخ محمد برجيس
طريق الألف ميل أوله خطوة
قد أكون من الأعضاء الذين طالبوا بوقف أحد مقاهيك
كنت مخطئا
فقد تطاول أحدهم على إحداهن
غضبت أنا
وللأسف
لم تغضب هي
وهنا تعلمنا الحياة كل يوم درس جديد
مقهى الملتقى .. في قفص الإتهام !!
بالعقل لا بالعين ....شوف كلماتي!
لست أدري سبب العداء المسبق و الهجوم المبكر
على كل فكر جديد او رؤية خاصة جديدة قد لا تروق للبعض!
الى من لا يعلمون ماهية الإبداع ؟
لهؤلاء المتشدقون بضرورة ترك ثوابتنا الحياتية بلا وعي .
و من أهم ثوابتنا لغة الناس البسيطة .
تلك اللغه التي يتحدث بها السواد الأعظم من الناس .
الى كل من لا تروق له كلمات مقهى الأدب الساخر .
الى خفافيش الظلام . المتربصه بكل جديد!
افهموا يا ساده ما هو الإبداع ماهيته و كينونته و أصوله ؟
الإبداع :
هو العملية التي تؤدي إلى ابتكار أفكار جديدة، تكون مفيدة
ومقبولة اجتماعياً عند التنفيذ .
وهناك تعريف شامل للدكتور على الحمادي، أورده ضمن كتابه الأول
من سلسلة الإبداع وهو التعريف التالي
"هو مزيج من الخيال العلمي المرن،
لتطوير فكرة قديمة، أو لإيجاد فكرة جديدة،
مهما كانت الفكرة صغيرة، ينتج عنها إنتاج متميز
غير مألوف، يمكن تطبيقه واستعماله"
كان أحد رجال الأعمال يقف في
طابور طويل في إحدى المطارات،
لاحظ الرجل أن أغلفة تذاكر السفر بيضاء خالية،
ففكر في طباعة إعلانات على هذه المغلفات
وتوزيع هذه الأغلفة مجاناً على شركات الطيران،
وافقت شركات الطيران على هذا العرض،
وتعاون رجل الأعمال مع مدير إحدى المطابع
وتم هذا المشروع، والنتيجة أرباح بملايين الدولارات!
الفكرة إبداعية وصغيرة، لكنها جديدة
ولم يفكر فيها أحد من قبل، وصار لهذا الرجل
زبائن من الشركات الكبرى في الولايات المتحدة.
*********
يزداد البعض غضبا و غيظا كلما شاهد فكرة بسيطه
مرمية على رصيف أخذها أحدهم ثم نظفها
و ألبسها ثوب جديد أظهر جمالها و نضارتها ؟
يغضب بسلامته و يغتاظ لا من نظافتها و جاذبيتها
بل يغتاظ لأنه لم يكن هو الفاعل لذلك ؟
و لسان حاله يقول ( ازاي فاتت عليا ) أنا غبي؟
عندما وافقت ادارة الملتقى على إفتتاحنا قهوة الملتقى
كمنتدى خاص ثار البعض و احمرت وجنتاه غضبا ؟
كيف نكتب بهذا الأسلوب . لأن بسلامته يكتب بإبداع
و هنا ملتقى المبدعين ؟ اذن لازم تكون كلماتنا ابداعية
و حروفنا مرصوصه بشكل عقد لؤلؤ علشان تروق لجنابه ؟
فهذا هو الإبداع من وجة نظر بسلامته و بسلامتها ؟
و للكل اقول .
الموقع الإلكتروني هو صحيفة تبث صفحاتها عبر النت .
و مثله في ذلك مثل أي صحيفة يتم الحكم على نجاحها
من خلال أرقام التوزيع . و عدد المتفاعلين معها .
لنري الصورة ادناه توضح مشاهدات موضوع واحد
وليد متى بدء و كيف انه في فتره وجيزه استطاع
جذب هذا العدد في اسبوعه الأول . سواء من زوار او معلقين

اسماعيل الناطور
01-26-2012, 01:17 PM
كمال الهلباوي وعلى قناة سي بي سي يفتي :
أن الإعتصام في ميدان التحرير هو فرض عين إلى أن يتحقق مطالب المعتصميين بتسليم السلطة لمجلس مدني
فهل الإخوان تناسوا أمانة المسلم من أجل اللعب السياسي!!!!!
فأنا الاحظ أن قادة الأخوان وضعوا يدا مع البرادعي
ووضعوا اليد الأخرى مع المجلس العسكري الأعلى ...
فلقد كانت هناك إشاعات وقد نقلتها في مشاركة سابقة
أن الأخوان إتفقوا مع البرادعي وما يمثل
-مجلس الشعب للإخوان
-والرئاسة للبرادعي
كذلك هناك إشاعات قد نقلناها أيضا سابقا أن هناك إتفاق آخر مع المجلس العسكري
إنجاز الانتخابات في موعدها
في مقابل مقاومة الهجوم على أدارة الفترة الإنتقالية وتركها للجيش حتى إنتخاب الرئيس المباشر من الشعب
لدرجة أن يستعد ليكون بديلا للشرطة في حماية الميدان
.....يجرى هذا والشعب لا زال ينادي عيش ..حرية
وهنا أفهم لماذا كان أول قرارات ثورة يوليو وعبد الناصر إلغاء الأحزاب

اسماعيل الناطور
01-27-2012, 01:13 AM
وهناك إجابتان يا دكتور أشرف ولكنهما بنفس المعنى مع الوعد بالرجوع مستقبلا
1-الحمار أولا من صدق أن هناك من يستطيع أن ينصب على شعب مصر ويقدم لهم ماسوني دجال قائدا لثورة عربية ورئيسا لمصر
2- الحمار اللي يصدق كذاب ولا يفهم معنى بيانه في هذا الوقت بالذات وقبل أيام من موعد الفتنة التي يخطط لها ...أما سمعت الكذاب يقول أنني لن أرشح نفسي إلا في جو ديمقراطي ....المعنى أن الرجل عنده أمل بهدم مصر في الفوضى القادمة ليرشح نفسه ثانية في جو ديمقراطي مقاس الماسون

كمال الهلباوي وعلى قناة سي بي سي يفتي :
أن الإعتصام في ميدان التحرير هو فرض عين إلى أن يتحقق مطالب المعتصميين بتسليم السلطة لمجلس مدني
فهل الإخوان تناسوا أمانة المسلم من أجل اللعب السياسي!!!!!
فأنا الاحظ أن قادة الأخوان وضعوا يدا مع البرادعي
ووضعوا اليد الأخرى مع المجلس العسكري الأعلى ...
فلقد كانت هناك إشاعات وقد نقلتها في مشاركة سابقة
أن الأخوان إتفقوا مع البرادعي وما يمثل
-مجلس الشعب للإخوان
-والرئاسة للبرادعي
كذلك هناك إشاعات قد نقلناها أيضا سابقا أن هناك إتفاق آخر مع المجلس العسكري
إنجاز الانتخابات في موعدها
في مقابل مقاومة الهجوم على أدارة الفترة الإنتقالية وتركها للجيش حتى إنتخاب الرئيس المباشر من الشعب
لدرجة أن يستعد ليكون بديلا للشرطة في حماية الميدان
.....يجرى هذا والشعب لا زال ينادي عيش ..حرية
وهنا أفهم لماذا كان أول قرارات ثورة يوليو وعبد الناصر إلغاء الأحزاب

أكد د.سعد الكتاتنى المتحدث الإعلامى باسم جماعة الإخوان ورئيس الكتلة البرلمانية، أن الإخوان يوافقون على أن يكون البرادعى قائدا لجبهة المعارضة، بشرط أن يكون بموافقة جميع القوى الوطنية ويوافق هو على ذلك، موضحا أن اختياره ممثلا للجماعة فى لقائه اليوم مع د.البرادعى للتعارف وليس لوضع أجندة معينة حاليا.
وأوضح الكتاتنى أن الدكتور البرادعى لديه رؤية ما زالت نظرية حتى الآن، وقد يخرج اللقاء بتشكيل ورش عمل لبلورة رؤيته فى برنامج عملى للتنفيذ على الأرض، مشيرا إلى أن هذه المقابلة لا تعنى رفضا أو تأييدا للبرادعى للترشيح لانتخابات الرئاسة، مضيفا أن جلسه اليوم للاستماع والتعارف بينهم وبين البرادعى الذى ظل لفترة طويلة خارج مصر ولم يلتق مباشرة مع القوى الوطنية ولا ممثليها وجها لوجه.
وذكر الكتاتنى أنهم كإخوان مع أى تحرك جماعى وطنى يهدف للإصلاح، مضيفا أن الأمر لا يتعلق بشخص البرادعى رغم تقديرهم الشخصى والوطنى له، إلا أن الأمر يتعلق بمبادئ ومنظومة للإصلاح وتوافق قوى وطنية، مشيرا إلى أن مثل هذه اللقاءات تكون للحديث العام بدون أجندات ولا موضوعات محددة، لكنه استدرك قائلا" الزخم الإعلامى الذى يستحقه شخص وقدر البرادعى، أوجد مناخا وضرورة لبحث الإصلاح بتفاصيل وزوايا مختلفة بالتركيز على التعديلات الدستورية والوضع فى الانتخابات الرئاسية، دون اتخاذ مواقف محددة حاليا".
وبسؤاله حول الدعوة التى وصلت الإخوان، هل كانت كجماعة ومكتب الإرشاد أم ككتلة برلمانية، أكد الكتاتنى أنه يحمل الصفتين لكن وجوده يمثل الإخوان كمؤسسة وقوى وطنية لا يمكن أن يتم اتفاق وطنى بين قوى سياسية بدون أن تكون جماعة الإخوان فى القلب، معتبرا أن قبول البرادعى كرمز أو قائدا للقوى الوطنية وجبهة التغيير القادمة لا يتم إلا بشرط أن يتم ذلك وفق توافق وطنى عام وقبول البرادعى شخصيا لذلك، معتبرا أن إخلال أى شرط من هذا يفسد الأمر، إلا أنه ذكر أن الأهم فى الأمر هو الحراك السياسى والنشاط الذى أحدثته رؤية البرادعى التى تتوافق عليها معظم القوى الوطنية منذ وقت طويل وتحتاج لبلورة عملية على الأرض.
اليوم السابع

اسماعيل الناطور
01-27-2012, 01:54 AM
و هل تتوقع يا أ / إسماعيل أن البرادعي لديه بالفعل أجندة إصلاحية
نابعة من وطنية خالصة ؟

أم انها أجندة فوضوية نابعة من أوامر خارجية !

بدون شك البرادعي وحسب التسلسل الوظيفي الذي يعرفه الجميع وحسب عضويته لمجموعة إدارة الأزمات العالمية والتي يمكنك العودة إلى ما هو منشور عن أعضائها وأهدافها وتمويلها ومعتقدات وجنسية الأعضاء تؤكد أن الرجل ما عاد لمصر إلا تحقيقا لهدف ولأهمية هذا الهدف فهو المؤتمن الوحيد على أسراره , لذلك تجد التصميم على دفعه لإدارة مصر مهما كلف ذلك من جهد , لقد كان الطلب وقبل قيام الثورة مجلس مدني برئاسة البرادعي ولا زال الطلب قائما وعلى عدة صور , وعندما فشلوا فرضوه من الميدان بطريقة فاشلة مما أدى إلى إعلانه الانسحاب من الرئاسة لدفع الأمور إلى التصادم مباشرة مع المجلس العسكري وهذا ما يخططون له الآن , والشعب المصري سيعرف يوما مقدار الضغط على المجلس العسكري لترك البلاد والعباد للماسونين , ولكنهم وقعوا مع رجال وهم أكثر من رجل واحد وهم قادة القوات لذلك الضغط على هذا العدد من القادة دفعة واحدة لن يأتي بثمار , فالمشير لا يحكم كما يتبادر لذهن العامة من الناس , المشير واحد من بين أكثر من عشرين قائدا هم أركان المجلس العسكري , لذلك كل المحاولات فاشلة وإذا إشتد الضغط على هؤلاء الضباط
فقد أميل لرأي مصطفى بكري بوقوع إنقلاب عسكري , فلقد فرض الله القتال على الأشراف ولو أن هذا سيناريو يريده البعض , ولكن أحيانا تجبرك الكرامة على الشهادة وتقبل الموت لكي لا تعيش ذليلا

اسماعيل الناطور
01-27-2012, 12:12 PM
http://www.youtube.com/watch?v=o0UgSzWKVN0
نشرت صفحة ثورة 25 يناير 2012 علي موقع التواصل الاجتماعي الفيسبوك تحريضآ صريحآ بالصور علي تفجير مبني ماسبيرو ,الأمر الذي جعل رواد الصفحة يتركون تعليقات لاذعة للأدمن الخاص بالبيدج علي انه خائن وعميل ولا يستحق لقب مصري كما ذكروا انه لابد من حماية مطالب الثورة ولكنه بهذا التحريض يضر بالثورة ويكره الناس بها.. الأمر الذي جعل ادمن البيدج يعتذر في بوست خاص عن هذا التحريض .
فجاء الأمر ايضآ ما لا يحمد عقباه وجاءه اكثر من تعليق يؤكد انه اثبت انه عميل ولا يمكن ان يصدقوه باعتذار لانه هكذا شعر بالخوف من فقد شعبيته قبل حشد الجموع لجمعة الغضب الثانية الأمر الذي جعل الأدمن في حيرة من امره حتي استقر علي مسح اي بوست خاص بالتحريض سواء بصورة مبني ماسبيرو وهو ينفجر او بالبوست الخاص بالاعتذار عما بدر منه من تحريض.

اسماعيل الناطور
01-27-2012, 12:35 PM
ماذا سيبقى من كرامة مصر إذا فقدت جيشها ؟
فبعد أن أفقدها دجالي الاعلام والفضائيات كرامتها , وأصبحت مصر تقودها فضائية من خارج مصر .....
وبعد أن أفقدها المال والديون قرارها المستقل , وأصبح المسلم المتشدد ينافق إتفاقية مع العدو وكان قد أحل دم من وقعها,فأصبح مدعي الاسلام طالب مصلحة ....
وبعد أن أفقدها البعض قيمة الشهادة وأصبح معنى الشهادة في الحواري وليس على الحدود مع العدو .....
وبعد أن أفقدها البعض كرامة الفرد , فأصبح النفاق تشريفا وبيع الضمير وطنية والسمع والطاعة لطلب الماسون حرية , وشتم العاهرات والمدمنات للشرفاء ديمقراطية
وهنا سأطلب من القارئ أن يفكر في العناصر الباقية والتي تمتلكها مصر لتبقى لها حضارتها وقيمتها كرائدة لأمة العرب !!!!







http://www.youtube.com/watch?v=LqHHFalBRFc

اسماعيل الناطور
01-27-2012, 02:30 PM
سؤال...حول قذارة الشعارات المرفوعة الآن في الجزيرة نقلا عن الميدان
هل يعرف الحمار إنه حمار ؟
وهل يعرف الحمار أن النجاح في إسقاط مبارك لم يكن أن يتم إلا بموافقة الجيش ؟
وهل يعرف الحمار أن نجاحه الآن في إسقاط المجلس العسكري إحتماله صفر طالما أن الجيش معاه ؟
وهل يعرف الحمار أن الشعب المصري هضم اللعبة وأخذ ما أراد من الثورة وإنه لن يتنازل عنها لحمار البرادع ؟
وهل يعرف الحمار أن مصر لا تقبل القسمة ؟
وهل يعرف الحمار أن أيامه أصبحت معددوه وأن الرهان على أموال الماسون أصبح مقرفا حتى للطفل المصري ؟

اسماعيل الناطور
01-27-2012, 02:36 PM
ست حمير تحرريين
وست حمارة متحررة
إجتمعوا لمناقشة المبادئ العامة لعد الأصوات في أي إنتخابات قادمة
وعند مناقشة بند المساواة بين الذكر والأنثى
قالت الست الحمارة :
...بما إنكم ستة وأنا ست ...
فصوتي بستة أصوات
فطلب رئيس اللجنة التصويت على الإقتراح
إعترض خمسة من الحمير ....ووافق واحد
فأعلن رئيس الجلسة
النتيجة ...خمسة معترض....وسبعة موافق




[



خبر عاجل ..

نظرا لعدم الإقبال على ركوب الدواب ..

فإن مؤسسات وجمعيات التنقل الدولية

ومساهمة منها في نصرة التنقل على الظهور..... وخاصة ظهور الحمير

تعلن عن تحركات ومؤتمرات ومؤامرات لتنظيم

مليونية سبت الحظر الجوي




...



نظرا للظروف الجوية العالمية السيئة
وإنعدام رؤية البعض بسبب الهبوط الحاد في بورصة الدولار
والخوف والقلق والتردد الذي ساد الجيران من الحر القادم
فلقد تم إلغاء مليونية سبت الحظر الجوي
والدعوة لمليونية سبت لطم الخدود والمدن المنكوبة






هالحمار مو لهالعرباية

http://i3.makcdn.com/userFiles/a/n/anaadam/images/77.gif

يظهر لا الجامعة نافعة
ولا الناتو معاه فلوس
ولا عندنا عقل يشفع
يا خسارة
باين راحت علينا

اسماعيل الناطور
01-27-2012, 09:45 PM
http://www.youtube.com/watch?v=YRqaNkE0Q0w

اسماعيل الناطور
01-27-2012, 10:42 PM
تحياتى البيضاء

الأستاذ إسماعيل الناطور

فى الحقيقة بعد قراءتى للموضوع ورغم اتفاقى معك فى بعض النقاط التى وردت فيه ، فإننى أجد أن عنوان الموضوع لا يليق بك ولا بالمتلقى ولا بأية حال من الحوار أو النقاش السياسى ، كمتلق أجدنى أمام عنوان أقرب للردح وليس أمام عنوان لنقاش سياسى ، لا يوجد نقاش أو حوار قائم على سب الآخرين ووصفهم بالحمير أو بالغباء أو غيرها من الألفاظ التى لا تدل على حجة قوية بل على حالة من التردى بالخطاب إلى مستوى لا يليق بمفكر وأستاذ جامعى كما فعمت من معرفك ، لا أحسب أن موقفك من البرادعى أو غيره يسول لك أن تسبه هو أو غيره بهذا السباب أو تسب المؤيدين له وتتهمهم بهذى الطريقة عبر القص واللزق أو الانطباع ، هذا كله لا علاقة له بالتفكير أقصد التفكير العلمى القائم على الحجة والبرهان وقبل ذلك كله احترام الآخرين مهما اختفلنا معهم فما أسهل السب والخطابة الجوفاء وما أعظم الحكمة والإصغاء واليقين


صباح الخير وتحياتك البيضاء مقبولة , ولكن ألا تجد نفسك قد تأخرت كثيرا في طرح رأيك فنحن الآن على أعتاب النهاية لموضوع إستمر لأكثر من نصف عام والمشاركات قد وصلت لأكثر من 740 مشاركة , وكنت أتمنى أن توثق النقاط التي إتفقت معي فيها , وبعدها يمكننا أن نتفاهم على العنوان ....ولماذا تحول عن عنوانه الأصلي الذي كان ( الوجه الماسوني للثورة ) كموضوع منفصل عن الوجه الوطني والوجه الحزبي للثورة , المشكلة لم تكن أبدا في العنوان , المشكلة كانت فيمن وصفناهم بالحمير , خمسة من الدول العربية تعيش مأساة البعض من أولادها , كان ربيعا عربيا يتمناه كل شريف , ولكنه كان من ناحية أخرى هدفا ماسونيا ينساق فيه البعض دون وعي ولا عقل , اتألم مثلك لما وصلنا له في الوصف , ولكن بعد أن أقرأ نقاط الإتفاق , قد أبحث معك عن عنوان آخر يليق بما سنتفق عليه .
[/b][/size][/color][/font]

اسماعيل الناطور
01-27-2012, 10:45 PM
فى الحقيقة أستاذ إسماعيل سواء كانت تحذرنا من التتار أو الجن الأزرق لا أجد أن أى حديث يكون لائقا تحت مثل هذا العنوان السخيف الذى يهين الملتقى كمنتدى للمثقفين كما يهين المتلقى حيث يضعه أمام نموذج مبتذل للحوار بما لا يليق بمن يكتب أنه مفكر وأستاذ ، بإذن الله حين تتكرم بتغير هذا العنوان السخيف وغيره من العناوين الرخيصة التى بمعرفك يمكننا أن نتحاور


بسم الله الرحمن الرحيم
مَثَلُ الَّذِينَ حُمِّلُوا التَّوْرَاةَ ثُمَّ لَمْ يَحْمِلُوهَا كَمَثَلِ الْحِمَارِ يَحْمِلُ أَسْفَارًا بِئْسَ مَثَلُ الْقَوْمِ الَّذِينَ كَذَّبُوا بِآيَاتِ اللَّهِ وَاللَّهُ لا يَهْدِي الْقَوْمَ الظَّالِمِينَ
صدق الله العظيم[/b][/size][/color][/font]

اسماعيل الناطور
01-27-2012, 10:48 PM
تحياتى البيضاء

فى الحقيقة النص القرآنى له قدسيته وخصوصيته منها أنه خطاب ربوبية ، أى أنه ليس خطابا بين أنداد بل من رب إلى خلقه ، لذا لا يصح لك أن تقيس خطابك بخطاب الله عن بعض خلقه ، فهو خطاب صادق لا يحتمل إلا الصدق لصدروه عن الرب الخالق،أما أنت كبشر فليس لك أن تدعى لنفسك الفهم واليقين وتصم غيرك من البشر بأنهم حمير لأنهم ليسوا على ما ترى ، أستاذ إسماعيل أرجو أن تسمع إلى نصحى وتكف عن هذا اللغو ، وأنا لا أقصد القص واللزق وصياغة ما تقرأه فى الجرائد بلغة ركيكة ونشره هنا فهذا شأنك أنت حر فيه ، بل أقصد توقف عن هذى العناوين الرخيصة التى تهينك أنت أولا ثم تمثل وصمة للمنتدى حيث تظهره بمظهر بائس كمنتدى ثقافى أدبى


لا أدري هل التسامح مع البعض يعتبروه ضعف !!!!
فبدلا أن يحاسب نفسه ويعيد صياغة أفكاره الركيكة , يتعالى ويعود بلهجة أكثر سخفا , على العموم , أنصحك بإعادة القراءة حتى تنمو لديك أفكارا تعلو على مستوى الأفكار الركيكة
وتفهم أن القص واللزق هنا هو محاولة لجمع قرائن للقارئ ليتابع ما يجري
وأعدك أن الموضوع شارف عاى نهايته , فالحمير اليوم تأخذ درسا جديدا , وقريبا سنغلق الموضوع لإستنفاذ الغرض منه , الشورى قادم والرئيس المنتخب قادم , والجيش المصري باق بكرامة وعزة تاريخ مصر
بسم الله الرحمن الرحيم
وَلاَ تَكُونُواْ كَالَّذِينَ قَالُوا سَمِعْنَا وَهُمْ لاَ يَسْمَعُونَ
إِنَّ شَرَّ الدَّوَابَّ عِندَ اللَّهِ الصُّمُّ الْبُكْمُ الَّذِينَ لاَ يَعْقِلُونَ
وَلَوْ عَلِمَ اللَّهُ فِيهِمْ خَيْرًا لَّأَسْمَعَهُمْ وَلَوْ أَسْمَعَهُمْ لَتَوَلَّوْا وَّهُم مُّعْرِضُونَ
صدق الله العظيم
[/b][/size][/font][/center][/b][/size][/color][/font]

اسماعيل الناطور
01-27-2012, 10:50 PM
و ما الفرق أن نصم إنسانا بأنه أسد
و إنسان اخر بأنه حمار
أليس الإثنيين من الحيوانات
فلما نقبل الأولى و لا نقبل الثانية
بالطبع لأننا نفهم الأولى جيدا
و الثانية ربما نصرفها للأسوأ دائما
رغم أن الحمار ليس غبيا و لا عبيطا
و إن شئت التأكد فأركبه لمشوار واحد الى مكان محدد
ثم كرر المشوار مرة اخرى ستجده يسير وحده دونما توجيه منك
الحمار ليس بغبي لكننا إتخذناه رمزا للغباء فقط
و لكن من اهم ميزات الحمار و ربما هذا المقصود هنا
أنه سهل التوجيه و الإنقياد دون تفكير !




سهل التوجيه والإنقياذ دون تفكير لدرجة ما يحدث الآن بين شباب الميدان بين الإخوان ومن هم ليس بإخوان , لقد أربكهم الجيش بعدم الرد والانسحاب , وأربكتهم الداخلية بالحزم والأمر بإطلاق الرصاص لأي تعدي على مراكز الشعب ومنشآته الحيوية ,والقبض على كثير من المشتبه بهم ..... فلم يبقى إمامهم إلا الإحتكاك بأنفسهم [/b][/size][][/font]

اسماعيل الناطور
01-27-2012, 10:52 PM
خاطبك الأخ محمد الصاوي بأدب حين قال لك:


تحياتى البيضاء

فى الحقيقة النص القرآنى له قدسيته وخصوصيته منها أنه خطاب ربوبية ، أى أنه ليس خطابا بين أنداد بل من رب إلى خلقه ، لذا لا يصح لك أن تقيس خطابك بخطاب الله عن بعض خلقه ، فهو خطاب صادق لا يحتمل إلا الصدق لصدروه عن الرب الخالق،أما أنت كبشر فليس لك أن تدعى لنفسك الفهم واليقين وتصم غيرك من البشر بأنهم حمير لأنهم ليسوا على ما ترى ، أستاذ إسماعيل أرجو أن تسمع إلى نصحى وتكف عن هذا اللغو ، وأنا لا أقصد القص واللزق وصياغة ما تقرأه فى الجرائد بلغة ركيكة ونشره هنا فهذا شأنك أنت حر فيه ، بل أقصد توقف عن هذى العناوين الرخيصة التى تهينك أنت أولا ثم تمثل وصمة للمنتدى حيث تظهره بمظهر بائس كمنتدى ثقافى أدبى"

وقد صدق في كل ما قاله، ولا أدري كيف تم الصبر على كل هذه التفاهات التي تُصاغ بركاكة، وتحت عنوان سخيف لا يليق بمنتدى ثقافي أدبي محترم!
أنت لم تسئ لنفسك فقط، بل تجاوزتها لتسيء لكل عضو، ومنتسب لهذا الملتقى، إنه لمخجل ما تشوّه به واجهة هذا المكان الراقي؛ فإن كنّا نعلم أنّ من" لم يستح يفعل ما يشاء" فالواجب على العاقلين هنا ألا يتركوه "يشطح" على هواه حفاظا على "حياء" الملتقى، وسمعته، ومستواه.






يبدو إننا حركنا العقول الراكدة ....
وسمع بنا من لا سمع له ولا بصر
وتوافد إلى هنا من لم نكن نعرفه
ولا جذبنا أدبه
أعتقد أن الرسالة وصلت
والجواب
أن كلمة الحق لا تستحي
ومن لا يريد أن يقرأها
فليبق بعيدا ....
ويتركنا مع مشاركاتنا الركيكة والسخيفة والعبيطة
فلقد إنقلب حال العرب
وأصبح كريم عامر ثائر
وعلياء المهدي حرة الحرائر

مؤيدي 6 ابريل لا تضع نفسك بين هؤلاء

مقطع فيديو فيه لقطات تخدش الحياء


يوتيـــوب (http://www.youtube.com/watch?v=jzgFf_5HIaI)

اسماعيل الناطور
01-27-2012, 11:17 PM
اظن ان هناك في الادب ما يسمى بالادب المكشوف
ادب الحب العصري
وهناك من كبار كبار الادباء من يدافع عنه
ويقول عن النص المكشوف ابداع
وبالقياس
يبقى هنا الناقد والمنقود
وأذكر هنا أن شاعرا كبير مثل الدكتور احمد حسن المقدسي نال على ابداعه الذي لا يجاريه فيه احد ما يكفيه من الشتائم
لانه قال الابداع
القصد:
نريد فقط قواعد يستقر عليها الادباء في الاخلاقيات
لنسير عليها دون ازدواجية او تصنيف

أهلا بك أخ يسرى هنا
وأتمنى أن لا يعتدي عليك أحد كما تم الإعتداء على وعلى الأخت إملي
ولكننا في عصر الدجال
والإزدواجية في كل شيئ
أمريكا تبيد الهنود
وإسرائيل تحرق غزة بالفسفور
ويطالعنا أذنابهم يوميا بعبارات الحرية وكرامة الانسان

اسماعيل الناطور
01-27-2012, 11:22 PM
سؤالي للمفكر اسماعيل الناطور المكرَّم: ما المكسب من وضع الفيديو ؟؟

أظن أنَّ لا ضرورة له وهذا تصرف فردي لا ينطبق على الجميع هذا اذا لم يكن مفبركا على انه في ساحة التحرير, يجوز أنه في جلسة خاصة...تحياتي

مساء الخير أخت أملي وجودك هنا قيمة
وجميل منك تعبير( أظن )
وأنا أظن
وما على الباحث الجاد إلا أن يجمع ما يظن
إلى أن يصل إلى الحقيقة
فهذا دور من يريد أن يكون مقنعا وصادقا

اسماعيل الناطور
01-27-2012, 11:34 PM
http://www.youtube.com/watch?v=0K_nUmTZ8iM&feature=share

اسماعيل الناطور
01-28-2012, 08:28 AM
الأستاذ المحترم / إسماعيل الناطور
السلام عليكم ورحمة الله وبركاته
أتمنى أن تكون لدينا القدرة دائما على التمييز بين الطيب والخبيث وعدم خلط الأوراق ، وأن يكون انحيازنا دائما للحق ندور معــه حيث دار .. دون انتظار لمديح أو لذم
تحياتي لك
الأخوة والأخوات الأعزاء
السلام عليكم جميعا ورحمة الله وبركاته
تعلمون جميعا مدى حرصنا في الأدباء (http://www.almolltaqa.com/vb/index.php) والمبدعين العرب" >ملتقى الأدباء والمبدعين العرب على توفير أكبر سقف من حرية الرأي والتعبير والدفاع عن حق النقد والرد دون إسفاف أو ابتذال أو سب أو قذف أو تحقير أوازدراء .. ورغم ذلك فقد وجدنا الكثير مما يتجاوز هذا السقف ويستعمل ألفاظا غير لائقة وأحيانا يعاقب عليها القانون .. وكنا نتحرج دائما من التدخل المباشر في الفصل بين المتنازعين تاركين ذلك لمراجعة النفس ، ولجهود بعض الأخوة .. حتى لايقال أن مدير الموقع يمارس ديكتاتورية أو تعسف أو انحياز .. وأقسم بالله أن أكثر من ثلاثة أرباع ما ينشر هنا هو ضد قناعتي الشخصية ، بل وأحيانا يصيبني بالألم والوجع النفسي .. ولكن إيماني بحرية الرأي وحق النقد والرد بلاحدود .. ليس منة على أحد ، ولكن لأنه حق اصيل من حقوق الإنسان عموما والأديب والمفكر خصوصا .. ولاأريد أن أذهب إلى ما ذهب إليه أستاذنا القدير محمد نجيب بلحاج حسين من اتهام لأشخاص بعينهم بتقاضي أموالا في مقابل الدفاع عن أنظمة فاسدة ، ولاأريد أن نحاكم النوايا ونكل أمرها إلى الله .. ولكنني وعلى الرغم من كل تلك القناعات لست على استعداد والكلام موجه للأستاذ الناطور ومن ينحو منحاه إلى تكرار تجربة أبو صالح من جديد ، ولست على استعداد للتضحية بالمزيد من كبار الأدباء والنقاد والمفكرين من أجل الإبقاء على أي شخص يستعمل هذه اللغة في وصف الأعضاء بالحمير وغيرها من الأوصاف وحاشاهم .. لذلك كله أرجو من الأستاذ الناطور أن يعتبر كلامي هذا بمثابة الإنذار الأخير .. وعليه أن يعود لسابق عهده في تناول المواضيع بلغة مهذبة .. وإلا فإنني أعتذر ومن الآن عن قبول عضوية الأستاذ الناطور في الملتقى (http://www.almolltaqa.com/vb/index.php) مع كل الاحترام والتقدير لشخصه .. وهذا كلام واضح .. وأكرر مرة أخرى لست على استعداد لأن أكرر تجربة " أبو صالح " مرة أخرى .. وهذا آخر كلام لي في الموضوع وسوف أقوم بإغلاقة .. مع رجاء عدم التعليق ممن لديه صلاحية الإضافة حتى لايتسع الخرق .
تحياتي لكم

أتمنى أن تكون لدينا القدرة دائما على التمييز بين الطيب والخبيث وعدم خلط الأوراق ، وأن يكون انحيازنا دائما للحق ندور معــه حيث دار .. دون انتظار لمديح أو لذم.....قالها صاحب الملتقى ...والتقدير لأي موقف هو مجموعة من المعطيات التي بالضرورة قد لا يتفق عليها إثنان ولكن صاحب الدار ...صاحب الكلمة العليا ومن حكم بماله ....
ولو صبر القاتل على المقتول ...لأقفل الموضوع ( الوجه الماسوني للثورة ) اسماعيل الناطور بعد عدة أيام , فسبعة شهور , من البحث والتنقيب كانت كفيلة بوصول الرسالة كاملة إلى من يعنيه الأمر ....
وحيث أن لكل موضوع نهاية , فالموضوع وصل إلى ذروته هنا وحرك المياة الراكدة لذلك يتم الآن جمعه تمهيدا لطبعه بكتاب يحمل نفس العنوان , ونفس المشاركات , وأتمنى أن تشتري منه نسخة من الأسواق قريبا , وأملى أن تضاف هذه المشاركة إلى الموضوع الأصلي ....ونقدم لك جزيل الشكر والتقدير لتحملك لنا في بيتك , لكن مصر وسوريا الوطن تستحق منا الجهد والتحمل وحسابنا وحسابك وحسابهم يوم الحساب , وما النصر إلا من عند الله

اسماعيل الناطور
01-29-2012, 12:52 PM
أستاذ إسماعيل الناطور

معذرة انشغلت عنك قليلا أمس حيث كنت أقلم أشجار الفيكس فى شارعنا أنا والشباب ، والحمد لله تمت المهمة بالنجاح ، نرجع الآن إلى ما كنا فيه ، فى الحقيقة مشاركتى التى تضعها بين قوسين أشرف من كل ما كتبت أنت فى هذا المنتدى من غثاء لأنها مشاركة تنتصر لمن تسبهم دون وجه حق إلا القص واللزق ، وإذا كنت تتكلم على شخصى مرة أخرى وتقول أنى لم التزم بالأخلاق والأدب ليس لى إلا ان أقول لك أنه لو كانت لديك أخلاق ما كنت تصف الناس بالحمير والماسونية والشذوذ لأنك قرأت هذا فى جريدة تقص وتلزق لنا منها ، وإذا كنت تدعى أنك من دعاة الأدب والفهم فى هذا المنتدى فأنت فعلا دعى كذاب ويكفى فحسب أن أذكر أنك تنوى أن تكتب مقالا فى " الأدب الشاخر " وإنى أحيل كل من يقرأ تعليقى هذا أن يتأمل هذا الوصف البذىء الذى تصف به نصوصا فى ملتقى أدبى ثقافى ، أستاذ إسماعيل أيها المفكر والأستاذ الجامعى هذا آخر تحذير لك احترم نفسك ، أنا لو راجعت ما تكتبه – أقصد ما تلزقه - لفضحتك على رؤوس الأشهاد .. أخطاء نحوية ولغوية مهولة لا يقع فيها الأطفال الصغار ، وقص ولزق بلا توثيق ولا تفعيل لقواعد الاقتباس التى يفترض بك كجامعى أن تعرفها ثم تتبجح بعد ذلك بالسباب وفحش القول ، أستاذ اسماعيل احترم نفسك ، هذا آخر تحذير لك
الشعب المصري شعب نكتة , ولم يترك فرعون ولا عميل ,إلا وسجله في التاريخ بنكتة مناسبة ,
وهذه إحدى الصفحات
http://ar-ar.facebook.com/pages/%D9%84%D9%85%D8%A7-%D8%B1%D8%A6%D9%8A%D8%B3%D9%83-%D9%8A%D8%A8%D9%82%D9%8A-%D8%A8%D8%B1%D8%A7%D8%AF%D8%B9%D9%8A-%D9%8A%D8%A8%D9%82%D9%8A-%D8%A7%D9%86%D8%AA-%D9%84%D8%A7-%D9%85%D8%A4%D8%A7%D8%AE%D8%B0%D8%A9-%D8%AD%D9%85%D8%A7%D8%B1/131437023638631
التى تقدم مؤشرات على وعي الشعب , , رغما عن أنف الشعب ,
الذي ما زال يبحث عن عيش وحرية بينما هناك من يسجل أرقام قياسية في الدخل الشهري ,أمثال نجوم الفضائيات المصرية مثل ابراهيم عيسى ومحمود سعد وصغار الكتبة ومدعي الأدب في الجرائد والمجلات والملتقيات
http://www.methak.org/ar/uploads/gallery/2912010-054611AM.gif
وهذا نوع آخر من التعبير ,كاريكاتير يقدم نوع من روح الدعابة المصرية ذات القصد السياسي العميق

اسماعيل الناطور
01-29-2012, 12:53 PM
رغم أننا قد أصبحنا قاب قوسين أو أدني من انتخابات الرئاسة ، ورغم أن اليوم إن شاء الله سيعقد أول مجلس نيابي منتخب بنزاهة وحرية .. وبين هذا وذاك أيام معدودات تفصل بيننا وبين انتخابات الشورى .. إلا أن بعض الأحزاب والقوى الممولة من الخارج والمتآمرة على الوطن ، والتي تعتقد أنها هي صاحبة الثورة .. وأن على الجميع أن ينصاع لأوامرها .. مازالت تصر بشكل مقزز على العودة للخطة الأصليــة للقوى العالمية المتآمرة والتي تتمثل في مجلس انتقالي برئاسة البرادعي .. والهدف طبعا اصدار مجموعة من القرارات الحاسمة التي تحقق تغيير هوية الدولة ، واسقاط الدولة ذاتها ، وفتح الباب أمام التدخل الأجنبي ، لأنه ببساطة هذا المجلس الانتقالي سيستمد شرعيته الوحيدة من القوى الأجنبية ، وليس من أي من المؤسسات السيادية التي سترفض الانصياع لــه بطبيعة الحال .. فمن الغباء الظن أن البرادعي أو غيره يملكون عصا سحرية لتحريك وإخضاع تلك المؤسسات السيادية .. لذلك أصر المجلس العسكري والتيارات الإسلامية والوطنية على احتضان ثورة الشعب وإلتقاط الكرة من تلك الجهات المشبوهة التي تصارع الزمن لتحقيق حلم المنظمات التي مولتها ، والسبوبة التي قبضوا لتحقيقيها الملايين .. وهذا هو جوهر الصراع القادم في 25 يناير 2012 والله غالب على أمره ولكن أكثر الناس لايعلمون

كشفت وثيقة تحمل شعار سرى للغاية من وثائق "ويكيليكس"
خصصت للدكتور محمد البرادعى المدير السابق للوكالة الدولية للطاقة الذرية
تحمل كود رقم 09 القاهرة 2279 حررت بتاريخ 10 سبتمبر 2009،
مشيرة إلى أن السفيرة الأمريكية السابقة مارجريت سكوبى، أكدت أن أعضاء بحركة 6 إبريل سافروا إلى الولايات المتحدة "سراً" وأعلنوا خلال مقابلتهم للإدارة الأمريكية تأييدهم للبرادعى مرشحاً للرئاسة فى مصر.

إنتهى الخبر من اليوم السابع ...
ولنبدأ بسؤال وسنحاول الإجابة عليه في مشاركات لاحقة
لماذا البرادعي بالذات ؟ ولماذا هذا الإصرار على شخصية مرفوضة حتى من المواطن العادي ؟ وما هي الصفات التي يجب أن يتمتع بها رئيس دولة مصر ؟

اسماعيل الناطور
01-29-2012, 12:55 PM
أستاذ إسماعيل الناطور

لقد حذفت من المداخلة السابقة ما تسافلت به على شخوص نختلف معهم لكن لا يمكن أن أسمح بأن ينحط الخطاب إلى وصفهم تلك الوصوف التى لا تجرؤ على وصفهم بها إلا لأنك آمن خلف لوحتك ، ولعلمك أنا لا أنتمى لا 6 أبريل ولا البرادعى ، بل وأقف منهم موقفا رافضا للكثير من أفكارهم لكنى لا أسمح لنفسى أبدا أن أخون أحدا أو أنعته نعوتا كالتى حذفتها من مشاركتك ، طيب على كل حال ليس هذا موضوعنا ، وبما أنى مدعى للأدب فسأشرح لك ما ورد من خطأ نحوي بمشاركتك السابقة :

- ولم يترك فرعون ولاعميل : الصواب ولا عميلا لماذا يا ناطورى العزيز هيا قل ورائى لأنها مفعول به منصوب بالفتحة الظاهرة ، لأنها ماذا شاطر أحسنت مفعول به منصوب بالفتحة



كشفت وثيقة تحمل شعار سرى للغاية من وثائق "ويكيليكس"
خصصت للدكتور محمد البرادعى المدير السابق للوكالة الدولية للطاقة الذرية
تحمل كود رقم 09 القاهرة 2279 حررت بتاريخ 10 سبتمبر 2009،
مشيرة إلى أن السفيرة الأمريكية السابقة مارجريت سكوبى، أكدت أن أعضاء بحركة 6 إبريل سافروا إلى الولايات المتحدة "سراً" وأعلنوا خلال مقابلتهم للإدارة الأمريكية تأييدهم للبرادعى مرشحاً للرئاسة فى مصر.

إنتهى الخبر من اليوم السابع ...
ولنبدأ بسؤال وسنحاول الإجابة عليه في مشاركات لاحقة
لماذا البرادعي بالذات ؟ ولماذا هذا الإصرار على شخصية مرفوضة حتى من المواطن العادي ؟ وما هي الصفات التي يجب أن يتمتع بها رئيس دولة مصر ؟
لقد أثرت التجربة الرئاسية المصرية الحديثة على وعي المواطن المصري رغم ما تقوم به حملات التضليل الإعلامي مستغلة كل شيئ من الكذب وتزوير التاريخ إلى إستغلال الحاجة وعدم الوعي لما يحاك من مؤامرات إقتصادية لخلق سوق عربي مستهلك , ومستهلك ليس لكل جديد بل مستهلك حتى لمن كان يقوم بزراعته أو صناعته من عهد الفراعنة , مرت التجربة المصرية بعهد ملكي إنقسم فيها الشعب إلى نخبة من الإقطاع وأغلبية من الفقراء لدرجة العدم , وتجربة رئاسية بثلاث محطات , محطة عبد الناصر ومحاولة أعادة منهج الإعتماد على الذات زراعة وصناعة , ومحطة السادات وأعادة منهج السوق الحر , ومحطة مبارك التي أعادت خضوع الشعب لسيطرة رأس المال الفاسد , لذلك فمهمة الناخب المصري أعقد مما يتصور البعض في حالة إذا ما تم تقديم نماذج محددة لمرشحين محددين لهم أجندات واضحة ولا تخفى عن عين مواطن شريف , لذلك فإن شروط المرشح للرئاسة يجب أن تكون من الذكاء بحيث لا تقدم نماذج على أساس الدعم المالي ولكن كيف ؟

اسماعيل الناطور
01-29-2012, 12:56 PM
لذلك فإن شروط المرشح للرئاسة يجب أن تكون من الذكاء بحيث لا تقدم نماذج على أساس الدعم المالي ولكن كيف ؟

ولكن كيف وشروط الترشيح تلقائيا تخضع لسلطة المال , فالفقرة 75 تبحث عن المواطن المصري صافي الإنتماء بدون تعكير إنتماءه بأوارق جنسية خارجية أقسم يمين الولاء لتلك الدولة عندما تم منحه ما أراد مبتعدا عن أصوله بمحض إرادته , ولكن المادة التالية المادة 76 لا تترك فرصة للترشيح إلا عن طريق الأحزاب وهنا خلفية الدعم المالي واضحة حتى للمرشح المستقل الذي يراد له جمع 30 الف صوت من 15 محافظة , المرشح الوطني الفقير ليس له مكان هنا أيضا , ويجب أن يتحالف مع المال لينفق ويجمع توقيعات 30 الف مواطن من 15 محافظة
ولنعود إلى شروط الترشيح حسب التعديلات الدستورية الجديدة
المادة 75 بعد التعديل
أن يكون رئيس الجمهورية مصريا ومن أبوين مصريين
وعدم حصول أى منهم على جنسية أخرى بخلاف الجنسية المصرية وألا يكون متزوجا من أجنبية.
المادة 76 بعد التعديل
1- أن يؤيد 30 عضوا على الأقل من أعضاء مجلس الشعب الشخص المرشح لرئاسة الجمهورية
2- أن يحصل المرشح على تأييد 30 ألف مواطن من 15 محافظة؛ بما لا يقل عن 1000 مواطن من كل محافظة
3- يمكن لأحد الأحزاب القائمة وله عضو واحد على الأقل فى أى من مجلسى الشعب والشورى "المنتخبين" ترشيح عضو من أعضائه لرئاسة الجمهورية.
خلاصة القول
أن المرشح لن يقدم نفسه مستقلا
بل يجب أن يقدم نفسه معتمدا على مال ما ....وهنا الخطورة
وهنا سر التظاهرات التي تطالب بإنهاء سيطرة المجلس العسكري الآن وفورا حتى تتم إنتخاب الرئيس تحت قوة المال والتمويل فقط

اسماعيل الناطور
01-29-2012, 03:58 PM
خلاصة القول
أن المرشح لن يقدم نفسه مستقلا
بل يجب أن يقدم نفسه معتمدا على مال ما ....وهنا الخطورة
وهنا سر التظاهرات التي تطالب بإنهاء سيطرة المجلس العسكري الآن وفورا حتى تتم إنتخاب الرئيس تحت قوة المال والتمويل فقط
واضح جدا أن المجلس العسكري يستشعر هذه الخطورة , خطورة فرض رئيس على الشعب المصري , ونظرا لدقة المواقف وحساسية الوضع الأمني , وقسوة الضغط الماسوني بأدوات القانون الدولي ومجلس الأمن والناتو والمعونات, وأن الحل العسكري غير متاح والحل الأمني غير متاح فهناك من فكر بليل وإختبئ وراء الجمعيات والمؤسسات التي تتعامل بالمال والدعم بالقانون , حاول المجلس العسكري إختبار الموقف والنيات , عندما عرض المواد القانونية التي تتيح لقوة الجيش الذاتية البقاء حتى في وجود البرادعي وخطة الماسون , وكان إختبارا موفقا بعد ثارت ثائرة من كانوا يخططون لتفكيك الجيش تمهيدا لتفكيك مصر , لذلك عاد وأصر على حماية مصر بشعبها وعن طريق صناديق الانتخابات , مجلس شعب منتخب , مجلس شورى منتخب , رئيس منتخب , وفي ظل حماية الجيش لعل وعسى أن يكون قادرا على حماية مصر بأقل الخسائر , لذلك تجد الطرف الآخر , يرفض إنتخابات مجلس الشعب بالاعتصام وفرض وزارة على مصر بالبرادعي وأعوانة , والآن يحاول وقف إنتخابات الشورى والرئيس فيما يجري ويجري في الميدان وماسبيرو

اسماعيل الناطور
01-29-2012, 04:31 PM
أخي الكريم الأستاذ إسماعيل الناطور ، تحية طيبة وبعد

واسمح لي أن أتدخل في الموضوع بهدف الإصلاح بين الأخوة وتوضيح أمر هام أراه غائبا قليلا عن المنتدى

كنت قد كتبت في تقرير الملتقى السابق حول نقطة تضارب الأراء السياسية للأخوة وشرحت هناك أربعة نقاط أراها ضرورية لحسن سير الحوار بين الأخوة جميعا ، ولن أقوم هنا بنسخ تلك المشاركة ولكن ما أرى أنه يتكرر كثيرا في الحوار بين المشاركين هو أن بعض المشاركات ونتيجة التباعد الومني في متابعة الحوار تظهر وكأنها عدائية أو هجومية على رأي سياسي آخر ، مما يؤدي إلى سوء الفهم بين الأخوة أحيانا

وفي الموضوع الذي أشرت إليه تظهر هذه الظاهرة جلية ، وأظن ( والله أعلم ) أن ما حدث هو أن الأخ محمد الصاوي السيد حسين قد قرأ عنوان الموضوع الذي كنت تكتب فيه على مدى الأشهر الماضية على شريط المشاركات دون أن يعرف أنك افتتحه تحت أسم آخر ، ولعله لم يطالع للموضوع من أوله ، وعلى الأغلب فإنه تصور أنك تكتب ضد الثورة المصرية أو أنك تنتقص منها ، وصحيح أن المتابع القديم يعلم أنك من مؤيدي هذه الثورة وبشدة وأن موضوعك هو للتحذير من خطر الثورة على الثورة ولكن عنوان الموضوع قد يكون هو السبب الأساسي في بناء هذا التصور لدى الأخ محمد ، وعلى الأغلب ( والله أعلم أيضا ) أنه تصور الوصف الذي تستخدمه للذين يحاولون تخريب الثورة المصرية قد حسبه وصفا للثوار وليس لأعداء الثوار

أقول ذلك وقد رأيت أنك قمت بإعادة العنوان الأصلي للموضوع يوم أمس وظهر من تصرفك لين تجاه أخيك محمد ، وأظن كذلك أنه لم ينتبه إلى إزالتك لما أزعجه من عنوان موضوعك وإلى إزالتك لصورة البرادعي من توقيعك ، وعلى كل حال فالأمر بسيط وهين بإذن الله ، ويمكن إزالة التوتر بين الأخوة دوما عن طريق الحوار الهادئ والنية الطيبة ، ويمكن كذلك بواسطة شرح الهدف من الوضوع وبيان غايته التي لا شك أن الأخ يقف ضدها ، أن يزول أي عارض على علاقة الأخوة مع بعضهم ، وأرى أن إعتراض الأخ محمد كان على استخدام كلمات محددة في عنوان الموضوع ، ولكن مشاركته التالية ربما هي التي أثارت رد فعل لديك وجعلتك تتراجع عن تراجعك

ولذلك أخي إسماعيل ، وحيث أنك استجبت لدعوة أخيك محمد وقمت بما يطيب خاطره ، وحيث أن الأخ محمد لم تصله بادرة حسن النية تلك بعد ، فما رأيك أن تعود إليها مرة أخرى وأنا آمل أن تصله هذه المرة وأن يزول هذا التوتر بينكما بإذن الله تعالى ، وآمل فعلا أن يجد الأخ محمد في بادرتك دليلا على احترامك لمشاعره وأن يساهم ذلك في عودة المياه إلى مسارها

وسأستغل هذه الفرصة كي أدعو الجميع وأولهم الأستاذ محمد الموجي كي نضع إتفاقا أخويا بين جميع الأخوة هنا ينص على عدم قيام أي مشارك بالتعرض لأي مشارك آخر بشكل شخصي ، وصحيح أن الشخصيات العامة يمكن نقد سلوكها وتصرفاتها المؤثرة على الشأن العام ، ولكن التعرض الشخصي لأي أخ في هذا الملتقى هو عامل تفريق بين الأخوة ، ونحن بحاجة شديدة وماسة إلى كل ما يوحدنا ويجمعنا على مستوى الأمة ، فكيف بنا على مستوى ملتقى فكري يناقش قضايا هذه الأمة

أذكر مرات عديدة أني تدخلت في حوارات بين الأخوة وكثيرا ما لاحظت أن قراءة المشاركة بشكل محدد ومبني على كلمة هنا أو كلمة هناك قد جعل القارئ يبني صورة غير دقيقة عن التوجه السياسي للكاتب ، وأحيانا أجد أن الكاتب يقصد شيئا وأن القارئ يفهم شيئا آخر ، ويحدث هذا مرة بسبب عدم دقة الكتابة ومرة بسبب عدم دقة القراءة

إننا في هذا الملتقى أخوة وهدفنا هو النقاش والحوار وليس منا أحد يحب أن يزعج أخاه بكلمة ، أو مغرم بالكتابة من أجل الكتابة فقط ، وكلنا نستفيد من حوارنا ونشذب أفكارنا وآرائنا بواسطة هذا الحوار ، لذلك أتمنى من الله أن يوفقنا جميعا إلى ما يحب ويرضى وأن يعذر بعضنا بعضا فيما نختلف فيه وخاصة في الأراء السياسية التي يفيد التنوع فيها ولا يضر بإذن الله

تحيتي لك أخي إسماعيل وتحيتي إلى أخي محمد الصاوي الذي آمل أن تصله هذه التحية وكذلك إلى الأخوة القراء جميعا
سبب

المشكلة في العقل البشري إنه عقل لا تتناسب قدراته مع ما يظن إنه يستطيعه , ولا يمكن أن يصل لمرحلة الكمال إلا بالتكامل مع العقل الجمعي , ولا يمكن أن يصل لإستنتاج صحيح إلا إذا إعتمد على المعطيات الصحيحة , وهنا تكمن مشكلة الحوار , قراءة العنوان والقفز للرد , مما يجعله من السخف بمكان قد لا يطيقه المتابع , ولكن تعودت على الصبر على المتصدي , لإنني أريد أن تصل المعلومة أو التحليل أو الفكرة إلى المتصدي ولا أريد أن أفتعل معه معركة كلامية , الكل فيها بطل وشجاع , فقاموس المفرادات متوفر حتى لطفل , البطولة هي في ميادين الشرف , أما بطولة المواقع والفضاء الإنترنتي هو الإقناع
ومن هو قادر على الأقناع فهو يحمل عقل جمع المعطيات المطلوبة , أما الغير قادر على الأقناع ....فإنه يستعرض عليك قاموس مفرداته ...وللإسف مفرداته تكون بمستوى الحماية التي يعتقد إنها تتوفر له
ونعود إلى موضوعنا وعنوان ثورة الحمير ,,,,,فهل يشك المعترض بعقول من شاركوا في الموضوع وعقول من أداروا الملتقى خلال عرض الموضوع طيلة هذه المدة , أحيانا الهدف يعمي صاحبه عن رؤية الحقيقة , والحقيقة أن الموضوع أفتخر به لإنه كان موضوع يتكلم عن المستقبل في كل مشاركة من بدايته حتى يوم الإغلاق والذي ترافق مع الذكرى الأولى للثورة المصرية التي أشعلها ورتب لها أطرافا ماسونية ولكنها بدأت في العودة إلى حضن الشرفاء الذين لولاهم ما كانت لهذه الثورة أن تنجح من شعب وجيش

اسماعيل الناطور
01-30-2012, 12:10 AM
لذلك تجد الطرف الآخر , يرفض إنتخابات مجلس الشعب بالاعتصام وفرض وزارة على مصر بالبرادعي وأعوانه , والآن يحاول وقف إنتخابات الشورى والرئيس فيما يجري ويجري في الميدان وماسبيرو



لذلك تجد الطرف الآخر , يرفض إنتخابات مجلس الشعب بالاعتصام وفرض وزارة على مصر بالبرادعي وأعوانه , والآن يحاول وقف إنتخابات الشورى والرئيس فيما يجري ويجري في الميدان وماسبيرو, فحصار ماسبيرو لا يمكن فصله عن هدف تحييد الوسيلة الإعلامية الوحيدة التي تتحكم فيها الدولة والمجلس العسكري في ما هو قادم من إنتخابات لرئيس الجمهورية , رغم ما يقوله البعض عن إنها محاولة للنتظيم , لأن الأمر لو كان في ذلك السياق , لرأينا أن المتظاهرين هم من رجال الاعلام وموظفي ماسبيرو وليس من عامة المتظاهرين وعلى رأسهم أمثال نوارة نجم وعلاء عبد الفتاح وهما من الوجوه التي إنتشرت عنهما في كل وسائل الاعلام من تصرفات تحبط أي محاولة لوضعهم في مجال الاحترام , وإذا رجعنا إلى بدايات الثورة , سنجد أن خطة إحتلال ماسبيرو كانت أول الأهداف التي أشار لها عمر عفيفي في توجيه التحركات وهناك فيديو بالصوت والصورة يوثق هذه الواقعة , إذن ماسبيرو هدف من أهداف فرض رئيس على مصر دون إتاحة الفرصة كاملة لكل القوى أن تلعب دورها وخاصة الجيش والحكومة وكل من لا يملك مالا لينافس به التمويل القادم مع العدد الضخم من الفضائيات الذي يحاول بكل الوسائل القيام بعملية غسيل دماغ جماعي للشعب المصري

اسماعيل الناطور
01-30-2012, 12:16 AM
كلامك أخي إسماعيل صحيح في حالة متابعة القراء لكل مشاركات كل الكتاب ، ولكن هذا صعب جدا ، ومن غير الممكن أن يتمكن أي من الأخوة أن يقرأ ويتحاور مع جميع أخوته حول كل القضايا ، وربما يقع أي منا في "غرام" العناوين الحادة أو في "انتقام" تلك العناوين أيضا ، ولكن ونحن نتذكر أسمهان وأنور وجدي ، فالحب "لازم" ينتصر آخرا

لعل الظروف الحالية وبداية نهضة العرب وسرعة تطور الثورات هي التي توتر أعصاب الجميع ، ولذلك ترى معظم الشكاوى تتعلق بالشأن السياسي وتبادل وجهات النظر فيه ، وهذا في حد ذاته مكسب عظيم من مكاسب الثورة وخاصة في مصر ( أقصد التبادل وليس الشكاوى ) وذلك عائد إلى معرفة العرب وإيمانهم بأن مصر هي الرأس وأن مصير العالم العربي مرهون بنجاح ثورتها ونجاتها من مكائد أعدائها ، ولو أتيح للعرب والمسلمين من المحيط إلى الخليج وما ورائهما أن يعبروا عن أمنيتهم أمام "جني المصباح" لاختاروا نجاح ثورة مصر كأمنية أولى ( يليها طبعا شقة وكيلو ذهب )

هذا التعلق الشديد بمصر هو السبب في خوف الجميع عليها ، ولعل بعضنا يزيد خوفه وتشتعل لهفته أكثر من بعضنا الآخر ، وربما يؤدي ذلك إلى أن يرى البعض الآخر تلك اللهفة زائدة أو مبالغا فيها ، تماما كما تكون تعبيرات الأم في لهفتها على وليدها أكبر من لهفة غيرها عليه ، وقد ينتقدها غيرها بسبب ذلك ، ولكن ذلك الإنتقاد لا يعني أن هناك خلافا أو نزاعا ، بل هو تنافس لمصلحة الوليد الجديد الذي يتبارى الجميع لتقديم الحب والحماية له

من جهتي أرى أن ثورة مصر قد قطعت مرحلة الخطر في الحمل وفشلت عملية إجهاضها ، وكذلك تجاوزت مرحلة الخطر في الولادة وفشلت محاولة وأدها ، وما زال أمامها مرحلة التغذية وستفشل عملية تجويعها بفضل الله أولا وبفضل تكاتف كل العرب على حماية مصر من الحرب الإقتصادية الوشيكة ، وها أنت ترى كيف سارت الإنتخابات وكيف ستمر الأيام وسيشتد عود الثورة خلال فترة قصيرة وستشب قوية رغم كيد العدا

المهم بالنسبة لنا في هذا الملتقى أن نتعاون على ذلك وأن يتحمل بعضنا بعضا وأن نعرف أن هدفنا واحد وأن لا نتوقف كثيرا عند أي فروق في مقدار اللهفة والحرص على الوليد الجديد ولنبدأ في التفكير في مستقبله وكيف سينمو ويكبر وأن نحلم ونعمل كي يصبح أسمه "وطني حبيبي الوطن العربي"

تحيتي للجميع وربما يعطيني الأستاذ الموجي لقبا بعد قراءة المشاركة ( هوه أنا أقل من يوسف بك وهبي بأيه )



شكرا لك أخي
ولقد قلت لك سابقا إنك من القلائل والقلائل جدا الذين يقدمون الفكر والأمل هنا , أثق في نواياكم الشريفة , ...وأعتبر من جهتي (أن الموضوع إنتهى) وأجرنا من الله ....وما أعمالنا إلا بالنيات[/font]

اسماعيل الناطور
01-30-2012, 12:20 AM
لن أزيد على كلامك الموزون أستاذ مازن وأرجو من كلا الأخوين إسماعيل الناطور و محمد الصاوي أن يحقنا هذا الخلاف وألا يفسد للود قضية فنحن كلنا أخوة ولا نريد أن يزيد الحوار الفرقة بل أن يقرب الفجوة التي صنعتها تلك الأنظمة المستبدة بين الشعوب العربية وأن نلتزم جميعنا أدب الحوار وأن نسمو فوق الصغائر ونتحاور حوار الأدباء والمثقفين العرب بحق وأن نحترم الاختلاف الذي لا يؤدي بنا إلى خلاف وأن نراعى الله في كل أعمالنا ويكون رضا الله هو غاية القصد فما يلفظ من قول إلا لديه رقيب عتيد دمتم بود ودامت أمتنا العربية متوحدة و قوية وأبية بفضل أبنائها الشرفاء


تحياتى البيضاء
أستاذى الجليل مازن أبو فاشا

أنا أشكرك أستاذى كثيرا لهذا النبل الذى أثمنه لكم ، وها أنا رغم استمرارأستاذ إسماعيل فى التعرض لشخصى واتهامى هنا بخيانة الأمانة وغيرها من التهم التى كنت أنوى الرد عليها بما يليق بها ، ورغم انشغالى بتقليم أشجار الفيكس فى شارعنا أجد نفسى لابد وأن أشكرك على نبلك وحضورك الكريم فأجدنى أتوقف عن الرد على الأستاذ إسماعيل لأوضح لك فى إيجاز فيما يلى :

- ليس بينى وبين الأستاذ إسماعيل الناطور خلاف شخصى ، ولاخلاف ناجم عن قفزى على السطور أو عدم قراءتى للموضوع ، الخلاف هو خلاف على الأسلوب نفسه ومدى ما يسمح الكاتب به لنفسه فى انتقاد اللحظة الراهنة وشخوصها عبر الخبر والرأى ،والانتقاد ذاته ليس المشكلة، فالشارع المصرى ذاته ينقسم إلى أكثر من فكرة حول الثورة منها ما يجنح إلى شيطنة الثورة ، ومنها ما يجنح إلى ملائكية الفعل الثورى وبينهما حالة من التذبذب بين هذا وتلك تحاول ان توفق بين الفكرتين ، وكمتابع للشأن السياسى أرى أن الأمر طبيعى خاصة فى مرحلة انتقالية مائجة سائلة ، وأن الخلاف طالما كان فى حدود الاحترام وبعيدا عن اتهامات التخوين الجزافية الاعتباطية فهو مفض حتما إلى استقرار وتحقق للفعل الثورى

- ونحن فى العمل معنا إخوة من حركة 6 إبريل وإخوة من السلفيين والجماعة الإسلامية وكذلك الإخوان ، ونتحاور دوما سواء قبل الثورة أو بعدها ، لكن على الإطلاق لم يحدث أن قبلنا بيننا أو سمحنا حتى لأحد أن يتهم الآخرين بالشذوذ وهى جريمة سب وقذف من الناحية القانونية ولا أريد هنا أن أتحدث عن السب شرعا وفقه البينة ، ولا سمحنا بأن يتهم الناقد لفصيل سياسى آخرين بالماسونية وهى تهمة فضفاضة أشبه بما كان يتداول فى بداية أفول العصر العباسى من اتهامات مجانية بالزندقة ، أو سمحنا لأحد أن يتهم الآخرين بأنهم حمير لاختيارهم الدكتور البرادعى وهو رجل نختلف ونتفق عليه لكن لا نسمح لأنفسنا بهذا التدنى فى الخطاب ، أو لم يقل أحد بيننا لمن تحاور معه أنه سيرسل برسيما لمن لم يفهم وكل هذا قاله الأستاذ إسماعيل ، لذا أستاذى هذا هو جوهر الخلاف .. الأسلوب ، فإذا تغير الأسلوب زال خلافى إما إذا بقى فأنا مضطر آسفا للرد عليه بما يليق


أخي الدكتور أشرف ...قد تكون قد قرأت سابقا لي هذه العبارة ( أنا أكتب كتابة مباشرة ولا أقرأ مشاركتي إلا بعد إرسالها , فأنا ليس وجودي هنا طمعا في أن أكون ممتهنا لمهنة الأدب , وجودي هنا طلبا لأفيد وأستفيد من أفكار الآخر خدمة لنفسي ولغيري في مقاومة تجهيل الآخر ذلك الأسلوب المتعمد من وسائل الإعلام , لذلك لا يهمني التركيز إلا على الفكرة ) ...شكرا لك ...فرغم إختلافنا في الحوار إلا إننا نختلف لنتفق , فلقد عرفت معدنك من أحاديث هنداوي , ذلك المصري المحب لتراب الوطن أكثر من حبه لهواه , دام بيننا حب الوطن , الوطن العربي الكبير من المحيط للخليج , ولن نسكت عن أعداء الوطن وأعداء أنفسهم من المغيبين , ومن يعارضنا عليه أن يقدم الدليل أو القرينة أو أي شيئ مقنع , أنا أن نسكت عن فلان أو علان لإنه صاحب أو صديق أو جار , فهذه ليس مجالها الملتقى كوسيلة من وسائل الإعلام , دخلنا طريقا نعلمه صعبا , ولسوف نستمر فيه هنا أو في موقع آخر , فالفراغ الفضائي يتسع للكل [/center]

اسماعيل الناطور
01-30-2012, 12:23 AM
السلام عليكم ورحمة الله وبركاته

أسعد الله مساءكم بكل خير وحب

سعدت بعودة الثقة والمودة إلى رحاب هذه الزاوية

الخلاف سنة ولكن الكبار يجعلونه فرصة لإثراء الحوار والتعرف على الآخر والاستفادة والإفادة

لاسيما لجمهرة الزوار المتابعين الذين

ازدحموا على أبواب هذا المنهل العذب

أخي إسماعيل الناطور

شكرا للطفك ولقلبك الغض الندي الذي استجاب للنداء

وللدكتور أشرف وافر الشكر والود

وللأخ الحبيب الكبير مازن أبو فاشا طاقات من الحب والشكر أن سعى بالخير والصلح

وللأخ الغالي عميد الملتقى كل الشكر والعرفان الذي يحسن امتصاص

الصدمات وتنفيس الاحتقانات

قد يكون هذا الملتقى خير ما الشبكة العنكبوتية في رحابة القبول والتلقي للآخر

والحوار بلغة راقية تليق بمفكرين كبار

والحركة إمارة الحيوية لكن تحتاج إلى ضبط الإيقاع

بين حين وحين

الله يعين عميدنا على المسؤوليات الجسام الملقاة على عاتقه في مختلف

المنتديات

الحمد لله الذي تتم بنعمته الصالحات

وصافي يا لبن

نتمنى أن نستفيد مما حصل من خلاف وتجاوز

وأن يكون لنا درسا في المستقبل

لنزداد ألفة ورقيا ولنكون في عيون القراء والزوار أبهى وأكبر

مساء الخير

ومساء الحب ومساء الورد للجميع




الأخ نايف
لأول مرة أوجه حروفي إليك , طبعا صافي اللبن , فهنا مجموعة من الأشخاص , قد نعطيهم أقل من قدرهم الحقيقي , وقد نعطيهم أقل من قدرهم الحقيقي , فنحن هنا مع شخصية نتية نتعرف عليها من بين حروفها والذي هو مرآة صادقه عما تحمله من فكر أو وظيفة أو نفاق أو تبعية , كان لنا موضوع شيق , اسمه ويخلق من الشبه أربعين , وقد تم إغلاقه أيضا , فلم يطيق البعض صبرا , رغم أن الموضوع كان يعتمد على فكرة , كيف نتصور بعضنا الآخر من مشاركاته , ورغم أن الموضوع لم يحمل أسماء عند النقد , إلا إنه فجر خصومات مع البعض , كدت أجزم أن البعض يريدك أن تتصوره كما يريد هو وليس كما يفعل , وثق أن عبارتك صافي يالبن هو خلاصة ما أحمله لكل عضو هنا , رغم إني قد أختلف معك غدا عما تكتب عن سوريا بطريقة أتعشم أن تكون أكثر إقناعا , الاقناع أخي ما نريده هنا , وليس أسلوب عنزة ولو طارت , شكرا للطف مشاركتك هنا

اسماعيل الناطور
01-30-2012, 09:50 AM
كما وضحنا سابقا ...إنها معركة إنتخاب الرئيس ووضع الدستور وليس لأخطاء المجلس العسكري قادة أقوى جيش عربي لا زال متماسكا والسد المنيع إمام الفوضى والتقسيم والإهانة
إستمع كيف تدار ثورة (.....) لرجل مال علماني يتفق مع ما ينظر له العامة إنه إمام مسجد ويذكرون أسم مستوي من يقود التظاهر )نوارة نجم ( لتنظيف الإعلام كما يقول المغيبون
تسجيل مسرب لمدوح حمزة يتحدث الى مظهر شاهين الحق نوارة نجم دي واحدة مجنونة ..............


http://www.youtube.com/watch?v=0r3Yxtvyvz8

اسماعيل الناطور
01-30-2012, 07:46 PM
كما توقعنا ....فالمعركة في ماسبيرو الآن وما سيستجد من أحداث جزء منها معركة إنتخاب الرئيس
"المجلس الأعلى للقوات المسلحة المصرية" يصدر قانون انتخابات الرئاسة ..
القانون هو نفس ما ذكرنا سابقا من بنود حيث يلزم المرشح الحصول على موافقة 30 عضوا برلمانيا منتخبا أو تأييد 30 ألف مواطن ويحظر إذاعة استطلاعات الرأى فى اليومين السابقين للاستفتاء.........وغدا ,,,يبدوا إنه يوم حار جدا رغم برد القاهرة

اسماعيل الناطور
01-31-2012, 12:03 AM
الأستاذ أسماعيل الناطور
السلام عليكم
موضوعك المشار إليــه .. أنا الذي قمت بحذفه وقد كتبت أسباب الحذف .. فإعادة إنتاج الخلاف على غرار ما كان يحدث في السابق أصبح مرفوضا وأتمنى أن نتوجه جميعا بأقلامنــا إلى تناول القضايا الخامة بطريقة موضوعية بعيدا عن جر الشكل
تحياتي لك
[b]
سيأتي زمن ...وسيقول ضميرك ...إن هذا الملتقى الذي تملكه ...سجل فيه عضوا ... اسمه اسماعيل الناطور ...كان أحرص على سوريا من بعض أولادها ...وأحرص على مصر من كثير من أولادها ...ولكن إرادة الله ومعاقبته لمن تركوا أوطانهم للشيطان ستكون قاسية وأسرع مما تعتقدون ...المؤامرة واضحة لكل عقل وهبه الله الصبر على القراءة والبحث
الفتنة لن يوقفها إنتخابات ولا جمعيات حقوق إنسان ولا مجلس عرب ولا مجلس عجم ...الوعي فقط من سيوقف زحف الماسون عليكم ...قولوا الناطور مهووس بالمؤامرة كما قالها هنا البعض , لكن بيننا وبينكم أيام أو شهور . وأرى الندم قادم , كما الندم والمرارة على وجه كل عراقي شريف كان آمن وأصبح مشرد , وإلى اللقاء ...وهذه آخر مشاركة لي بينكم , وأرجوا أن لا تبخل على بالإحتفاظ بهذه المشاركات , ليبكي عليها أحدهم , أو ليسخر منها أحدهم ...

اسماعيل الناطور
02-02-2012, 12:25 PM
الأستاذ أسماعيل الناطور
السلام عليكم
موضوعك المشار إليــه .. أنا الذي قمت بحذفه وقد كتبت أسباب الحذف .. فإعادة إنتاج الخلاف على غرار ما كان يحدث في السابق أصبح مرفوضا وأتمنى أن نتوجه جميعا بأقلامنــا إلى تناول القضايا الخامة بطريقة موضوعية بعيدا عن جر الشكل
تحياتي لك



[b]
سيأتي زمن ...وسيقول ضميرك ...إن هذا الملتقى الذي تملكه ...سجل فيه عضوا ... اسمه اسماعيل الناطور ...كان أحرص على سوريا من بعض أولادها ...وأحرص على مصر من كثير من أولادها ...ولكن إرادة الله ومعاقبته لمن تركوا أوطانهم للشيطان ستكون قاسية وأسرع مما تعتقدون ...المؤامرة واضحة لكل عقل وهبه الله الصبر على القراءة والبحث
الفتنة لن يوقفها إنتخابات ولا جمعيات حقوق إنسان ولا مجلس عرب ولا مجلس عجم ...الوعي فقط من سيوقف زحف الماسون عليكم ...قولوا الناطور مهوس بالمؤامرة كما قالها هنا البعض , لكن بيننا وبينكم أيام أو شهور . وأرى الندم قادم , كما الندم والمرارة على وجه كل عراقي شريف كان آمن وأصبح مشرد , وإلى اللقاء ...وهذه آخر مشاركة لي بينكم , وأرجوا أن لا تبخل على بالإحتفاظ بهذه المشاركات , ليبكي عليها أحدهم , أو ليسخر منها أحدهم ...


بحكم سني أخي إسماعيل ، وطول خبرتي في هذه الحياة ( وهو ما أخفيه هنا في هذا الملتقى كي لا يسهم عدد السنين في هذا العمر عن زيادة في الإحترام أو ربما نقص فيه ) فعادة ما تصيب المدافع عن قضية ما لحظة يأس وغالبا ما تكون هذه اللحظة عابرة ( ربما لحسن حظ القضية أو سوء حظ المدافع عنها ) وغالبا ما يعود المؤمن بقضيته إلى ساحة الدفاع عنها بعد عبور هذه اللحظة ، وهذا ما أتوقعه منك أخي إسماعيل

ربما عندما تعود عن قرارك هذا وترجع إلى الدفاع عن قضيتك سأقول لك كم أبلغ من العمر وسأكتفي بأن أقول الآن أنني ولدت في الثالث والعشرين من شهر فبراير رغم أني كنت طوال عمري أتمنى لو ولدت في اليوم السابق له تماما:)

أخي إسماعيل ، إن الذي يدافع عن مبدأ يعيشه ويحمله على كتفيه لا يتقبل بسهولة أن ينسحب من الدفاع عنه تحت ضغط أن القانون في بلد ما يسمح وفي بلد آخر لا يسمح ، بل يجد طرقه للتكيف مع كل مكان تبعا لما هو ممكن ، والكاتب الذي يحمل هما لقضية يؤمن بها لا يسعه التبرم من حذف موضوع له ( مثلا ) وأن يكون ذلك سببا في ثنيه عن هدفه ، إذ أنه أساسا لا يكتب بهدف أن يكتب فقط ، هو يكتب لأن الكتابة وسيلة ، ولأن الهدف هو الإقناع ، وهذا جوهر العمله تجاه قضيته ، ولعل شدة ظروف بيئة ما عن غيرها هو مدعاة لأن تتطور الوسيلة ( وهي هنا الكتابة ) أكثر وتصبح فعالة أكثر ، وشخصيا وبكل صراحة أرى أن العمل في بيئة صعبة ( ولا أقصد الملتقى بذلك ) لهو أفضل من العمل في بيئة سهلة ، لأن ذلك مدعاة للنجاح أكثر فأكثر ، وتعطينا الطبيعة أمثلة كثيرة عن أن النجاح الذي يحققه النخيل في البقاء ضمن ظروف الصحراء أكبر من النجاح الذي يحققه نبات آخر في ظروف أقل قسوة

لقد كتبت في أول مشاركة لي في الملتقى أن سبب مشاركتي فيه هو هدوئه في الحوار بين الأخوة وأرى جهود الأخوة منصبة على إبقائه هادئا، وأرى أن أفضل نقطة أجدها موجودة هنا هي تباين آراء الأخوة حول القضايا السياسية ، وهذا بحد ذاته مكسب جيد لجميع المشاركين ، إذ لولا ذلك لأصبح الجميع من لون سياسي واحد ، ولأصبح الحوار مقصورا على عبارات الترحيب والتبجيل وغيرها من العبارات التي تراها منتشرة في الملتقيات ذات اللون الواحد التي يكرر فيها الجميع نفس المشاركات وذات الآراء ويصبح المكان منغلقا على ذاته كالذي يغني ليطرب نفسه ثم يقول لنفسه أحسنت

لا أظن أنه يخفى عليك أن الفكر بحاجة إلى ما يعارضه ، وأن الفرد الواحد قد يتقلب بين الرأي وضده حتى يثبت على ما يجمع شتات الآراء ويصقلها ، ولذلك أظن والله أعلم أنك ستعود عن فكرة التوقف عن المشاركة سريعا ، صحيح أن توقفك لفترة قد يكون من حسن حظ زوجتك وأولادك ، لكن ربما بعد أن تتفرغ لهم قليلا وتبدأ في التدخل في مجريات حياتهم بأكثر مما عودتهم عليه ، فإنهم هم من سيرجونك للعودة إلى الكتابة وسريعا جدا :):):)

أخيرا أخي إسماعيل ، وبالنسبة إلى موضوع المشاركة ذاتها ، وبعد قراءة مداخلات الأخوة الذين أشكرهم جميعا ، فالأخ محمد الصاوي لم يعترض على مضمون الموضوع وإنما اعترض على الشكل المستخدم في عنوان الموضوع وهو استخدام وصف غير مألوف ، ومتعارف على أنه وصف لا يتداول في الأوساط الثقافية ، ومما زاد الأمر حدة هو أنه لم يتسنى له أن يرى أنك قد قمت بإعادة الموضوع إلى عنوانه القديم "الوجه الماسوني للثورة" وكذلك الموضوع الآخر الذي لم يذكره هو ، وكذلك إزالتك للافتة الخاصة بالبرادعي من التوقيع الخاص بك ، وربما يعود السبب في ذلك إلى توقيت قرائته للمشاركات ، ولعلك رأيت كيف أنه وضح أن الخلاف معك حول هذه النقطة ليس له بعد شخصي ، وهذا أمر جيد ، أما فيما يخص حذف أخي محمد الموجي لموضوع جديد لك ( ولست على علم به ) فقد بين أن السبب هو الحفاظ على علاقة جيدة بين الأخوة جميعا ، وهذه نقطة هامة أخي إسماعيل وأرى من الجكمة أن يبتعد كل منا عن أي مما يزعج أخوته حتى لو كان ذلك على حساب أي تبديل الكلمات بكلمات أخرى أو اللجوء إلى التلميح دون التصريح ، فإذا كنا كأخوة وعرب غير قادرين على أن نتسامح مع بعضنا ولا أن نتحمل ضغط بعضنا على بعض في أمور بسيطة ، فكيف لنا أن نتوحد حول أمور أكبر من ذلك وأخطر ، وكيف لنا أن نواجه أعدائنا وهم موحدون ضدنا ، ألا ترى معي جوهر المشكلة ، إذا كان الدفاع عن قضية سيؤدي إلى ضياعها فهي ليست قضية إذن وأنت من قال أن القوة في الإقناع وليس في غيره

تحياتي إليكم جميعا وآمل من عائلة الأخ إسماعيل أن تضغط عليه كي يعود إلى الكتابة ثانية وأظن أن مدة يومين أو ثلاثة من ابتعاده عن الكتابة و"البحبشة" ولساعات طويلة في أمور العائلة ستكون كافية كي يعود إلى لوحة المفاتيح ثانية:):)



هل بكى أحدكم على بورسعيد ؟
بور سعيد التي قهرت العدوان الثلاثي على مصر!!!!!!!!!!!!!
إنهم ينتقمون .....والمغفلون ما زالوا ...يصرخون ...الشعب يريد إسقاط العرب والتاريخ والوطن
إن ما حدث في مباراة قدم في بورسعيد , سيتكرر .....ويتكرر ......
طالما أن هناك أحدا لم يميز بين( الحمار ) والثوار
ثلاث وسبعون شهيدا لفوضى يرتكبها العدو بيد مغفلون
قلنا لكم أياما وأحدكم سيبكي أو يستهزئ .....
فكان البكاء !!!!!!!
شكراأخي على شعورك ودعوتك لي بالعودة إلى التصدي لم يكتب بدون وعي ,
ويبدو أن المعارك في مواجهة قلة الوعي هو قدرنا وقدر كل شريف
سنعود كلما رأينا أن هناك ما يستلزم
حتى نعطي الفرصة لمبشري الثورة الماسونية أن يقنعونا إنها ثورة وطن

رجائي كامل
02-02-2012, 01:11 PM
الاخ الاستاذ اسماعيل المحترم
يلفت انتباهي في كافة مواضيعك عدد الزوار فأجدك تضرب الرقم القياسي في عدد المشاهدين اليومي لما تكتبه
وهذا يعني أن ما تكتبه نافع ومفيد ويجذب اليه المثقفين من القراء
وبالتالي رغم ان البعض يدفع بأنك ناقل للمادة العلمية فهو يتجاهل اسلوبك في صياعتها وتنسيقها لتكون متكاملة الابعاد
ولذا جدير بي وغيري ان نتوجه اليك بالتحية والتقدير على هذا الجهد المنهجي في تقديم المعلومة ضمن عمل متكامل

اسماعيل الناطور
02-02-2012, 01:28 PM
الاخ الاستاذ اسماعيل المحترم
يلفت انتباهي في كافة مواضيعك عدد الزوار فأجدك تضرب الرقم القياسي في عدد المشاهدين اليومي لما تكتبه
وهذا يعني أن ما تكتبه نافع ومفيد ويجذب اليه المثقفين من القراء
وبالتالي رغم ان البعض يدفع بأنك ناقل للمادة العلمية فهو يتجاهل اسلوبك في صياعتها وتنسيقها لتكون متكاملة الابعاد
ولذا جدير بي وغيري ان نتوجه اليك بالتحية والتقدير على هذا الجهد المنهجي في تقديم المعلومة ضمن عمل متكامل

الحمد لله
وما نريد إلا أن نستفيد ونفيد , فما وهبنا الله العقل إلا لنستفيد منه

اسماعيل الناطور
02-03-2012, 01:46 PM
ثورة الحمير بقلم اسماعيل الناطور

فمن هو الببغاء أو الغبي أو الحمار في تلك الحالة يا اسماعيل الناطور ومحمد شعبان الموجي ويسري راغب شراب ووو؟
غريب إنك لا زلت لا تعرفه , فلقد عرفه من خلال هذا الموضوع , من خلال غباءه وحميرته , كل من قرأ أو سمع ....إنه هذا الماسوني الكلب ......الذي سرق لقب الصلاح ولقب به نفسه أبو صالح
الاخ ياسر طويش الموقر
السلام عليكم ورحمة الله وبركاته
لا اتنازل واتحدث مع صهيب الجاسوس المكنى بأبي صالح ولذا اوجه خطابي اليك
واريد ان تعرف ان هذا البغل المنغولي
عاش طيلة حياته مابين دبي وتايوان
وهنا يلعب لعبة يهدم فيها كل بناء لكل الكتاب دون استثناء
مهمته ان يجعل الخيانة مجرد وجهة نظر
والاسئلة التي اود سماع اجابة منه عليها هي
كيف تعرف على زوجته واين تعرف عليها
وماهو عملها الاساسي قبل زواجه بها
والان
ما هي طبيعة اعمالة واين يعمل ؟؟
وما هي صلته بالعراق الان وسابقا ؟؟
ماهي ملته ودينه ؟؟
فقد عرفت انه بلا دين
وقد تخلى عن جنسيته العربية من اجل التايوانية
فاذا اجابك على هذه الاسئلة
حدد موقفك منه
لماذا يريد ان يجعل الخيانة مجرد وجهة نظر
لان تلك مهمته
نشر الفوضى الخلاقة
هو ترس في الة كبيرة توجه الى الفوضى الخلاقه
فالى متى ستبقي عليه وتتستر على افعاله
تقبل تحياتي

ملاحظة
بماذا تشتهر تايوان
بالخمر
وخادمات الفنادق
وقاعدة للامريكان
فمن يتعرف على تايوانية
سيتعرف عليها
في خمارة
ويتزوجها على ان تتوب باقي عمرها
بضمان الطرف الثالث عند توقيع عقد القران
http://www9.0zz0.com/2010/12/12/14/895116117.jpg


ما العلاقة بين تايوان والماسونية العالمية ....سؤال للتفكير

اسماعيل الناطور
02-03-2012, 02:48 PM
ثلاثية تقسيم مصر . تبدأ من بور سعيد !
الخطوة الأولى :
إن محاولة عزل محافظة بأكملها كبورسعيد عن باقي مصر
هو أولى خطوات التقسيم الحقيقي لمصر .
يحاول البعض معاقبة محافظة بورسعيد كلها بعزلها و التجييش ضدها
و تحميل مسؤولية ما حدث لكل الشعب و الجمهور البورسعيدي .
ليكون مستهدفا من كافة محافظات الجمهورية و ليكن شباب بورسعيد
مستهدفا من كل شباب الجمهورية ..
و عند نجاح السيناريو مع بور سعيد ينتقل لعزل محافظة أخرى
و هكذا تتعدد السيناريوهات لنصل لعزل كافة المحافظات عن بعضها
ثم تعود تلك المحافظات لتكوين إتلاف فيما بينها بعد ذلك ثم تكتلات
من خمس أو سبع محافظات معا ... و هكذا تنقسم مصر إلى ثلاث
أو أربع دول ... ربما تكون تلك خطة محكمة و مدبرة بذكاء ربما !


الخطوة الثانية :


إن التطور المذهل في مسرح الجرائم هذه الأيام و المتمثل في أسلوب جديد
لارتكاب الجرائم في مصر كالسطو المسلح على البنوك و أسلوب اختطاف
سياح أجانب و رهائن من الشعب .. ناهيك عن أسلوب التشاجر المسلح بين الشعب
كلها أساليب لم نكن لنراها إلا فقط في سينما هوليوود و كيف أن السطو يحدث
بعد دراسة و بإحكام .. و كيف أن الاختطاف يحدث بتخطيط مسبق و مطالب مبيته
و كذلك حمل المواطنين للسلاح و استخدامه في أي مشاجرة و كأنه عصا أو حجر طوب!

كل ذلك يصب في تهيئة الشعب لأسلوب الكر و الفر و السطو في حال انفصال
المحافظات عن بعضها البعض .. للبدء في وضع حجر أساس لمليشيات منظمة
تنتمي كل منها لمحافظة يعينها .. للدفاع عنها حال التعرض لهجوم من محافظة أخرى


الخطوة الثالثة :


الدفع بحملات فضائية و إعلامية و تظاهرات منظمة لا تهدأ مطالبة بإسقاط كل شيء
إسقاط مجلس عسكري .. إسقاط حكومة .. إسقاط مجلس الشعب .. إسقاط كل من يتحدث
باسم مصر .. إلى حملات التخوين لكل طرف ضد الأخر .. و الاتهامات المتبادلة بين الشعب و كل سلطة أو مؤسسة في البلد .

تماما كخطة ( الماغول ) قبل غزو مصر كان.. ( 1 ) قتل أقطاي لأنه ضد شرعية أيبك
هو تماما كمحاولة إسقاط مجلس الشعب و إزاحة الشرعية عنه بالرغم من انتخاب الشعب له . ثم إسقاط الحكومة بدعوى تقاعصها و عدم تحقيقها مطالب الثورة رغم قصر مدة توليها دفة البلاد في ظل أمواج
الغضب و الأحداث المتلاحقة بكل قسوة و ضراوة


( 2 ) قتل أيبك بغباء شجرة الدر


هو تماما كقتل المصري لأخيه المصري ببورسعيد
ثم لا حقا يأتي القضاء على الجيش بخطة محكمة من أعداء مصر سواء بالداخل او الخارج
إما بقطع ما وعدوا به من معونات أو بإثارة الفتن الداخلية التي تغذيها و تدعمها أيادي خارجية
تماما ( 3 ) كقتل شجرة الدر أخر ممثل للبلاد .. و للأسف كل الخطوات الثلاثة يشارك فيها الشعب إما بطرق مباشرة
أو طرق غير مباشرة ... و بغباء مذهل لسقوطنا المذهل أيضا في قراءة و فهم التاريخ !
و ختاما بعد تحقيق الثلاثة خطوات فصل المحافظات – إسقاط شرعية مجلس الشعب – إسقاط العسكري و الحكومة
ثم الجيش ... تصبح مصر بلا ممثل شرعي أو متحدث رسمي . ثم يأتي إلينا
( الطرف الثالث ) و يخاطبنا
بالقول الشهير ( لما أحب أتكلم مع مصر أتكلم مع مين ! ) ..
و للأسف لا يوجد ( سلامه ) الذي يدق جرس الإنذار .. و ينبأ عن قدوم الطرف الثالث قريبا !


فاكسات لمن يهمه الأمر !


1- لا تقولوا جفت من الحزن مدامعنا ... بل قولوا من لذاك الحزن يدفعنا !
2- أعيروا مصر الآن مسامعكم .. أبنائي لا تهدموني بسواعدكم !
بالله كفاكم تعطيلا للمصانع .. كفاكم غلقا للشوارع .. وكفاكم تجفيفا لمنابع الرزق !



3 - عايرتم عواد لأنه باع أرضه ... فاحذروا أن يعايركم التاريخ ببيع مصر !
4 - وراء كل ثورة .. فلول و حساد حاولوا إسقاطها .. و أغبياء ساعدوهم في ذلك !


5 - عندما يفشل فكرك في قيادتك لما تريد ... سيتقدم فكر غيرك ليقودك لما يريد !
6 - الناس تبحث عن حلول لدرء الفوضى ... و نحن نبحث عن مبررات لها – غباء-!


7 - شيء مؤلم قربك من الحرية ... و عجزك في الوصول إليها !
و الأكثر ألما .. أن تأتيك الحرية ... و تستعملها في قتل نفسك .. و غيرك أيضا !



مشاركة تستحق التفكير والرد عليها بعد دراسة , وخاصة إنها تتوافق مع ما حدث مع ما حدث من إنقسام فلسطيني بين فتح وحماس ....وكان الطرف الثالث الدولي الصهيوني يقول : من هو ممثل الفلسطينيين وعندما أريد أن أتكلم ...أتكلم مع مين !!!
وإنقسمت فلسطين إلى خمس دول

اسماعيل الناطور
02-04-2012, 09:06 AM
بكل تأكيد سننتظر تحليلاتك أ / إسماعيل
و قراءاتك للمشهد بصورة إجمالية من خلال تلك المقدمات
للفوضى و للتخريب .. و لا تسقط من حساباتك الدور الذي
تلعبة قناة الحظيرة !


المصيبة أتوقعها منذ سنوات منذ تقديم موضوع نظرية تسمين العجول ومخطط تقسيم المنطقة
المصيبة أتوقعها منذ أكثر من سبعة شهور منذ أن توافرت المعلومات عن خطة الثوارات الملونة والتمويل ومنظمة فريدم هاوس
المصيبة أتوقعها من حجم المعلومات المتواردة عن نوعية بعض من يقودوا هذه الثورات
المصيبة أتوقعها من مهزلة المليونيات دون سبب مقتع
المصيبة أتوقعها من حجم الاعلام والفضائيات والكذب والتلقين
المصيبة أتوقعها من حجم الضغط على مؤسسات الدولة كالشرطة والجيش والتي هي أجهزة تنقاد ولا تقود
المصيبة توقعتها من تصرف الجامعة العربية ومجلس الأمن الغير أخلاقي
لذلك قلت قبل أيام ....إنتظروا أياما وربما شهور وسنبكي إن لم نستيقظ
والآن نأتي إلى مجزرة بورسعيد والتي لا يمكن لأي عاقل إلا أن يقول إنها مدبرة ومدبرة بحكمة كما عودتنا المؤامرة منذ بدايتها والتي إعتمدت على مبدأ ...أن الفاعل والفعل يجب أن يتم بيد أهل البلد إن كان في مصر أو سوريا أو ليبيا أو اليمن
الفعل والفاعل يجب أن يكون من أهل البلد , حتى يمكن تقبل الجمهور لفكرة الثورة ويستبعد فكرة المؤامرة , وهنا يأتي الإعلام المدفوع الأجر كالجزيرة أو كثير من الفضائيات المصرية والعربية , هنا يأتي دور الاعلام , تكبير الكذبة , وتصغير المصداقية , والتركيز على الأخطاء , وتصيد المواقف ....
نقول ما حدث في بورسعيد مؤامرة لا شك ورأس المؤامرة معروف وهو من قدم لنا هذا الربيع على إنه ربيع عربي وليس ربيع شيطاني ماسوني يشترك فيه المال وقوى السيطرة العالمية والغرب القبيح
ولكن من هو الفاعل ومن هي الآيادي الملطخة بالدماء ...لذلك سنعود ونقرأ الحدث بهدوء
وسنقفز على النتائج وعلى طريقة التحقيق الجنالئ من المستفيد مما حدث ومن هو الخاسر مما حدث
المستفيد هو عمر عفيفي وكل من توعد وأعلن يسقط يسقط حكم العسكر
المستفيد هو من رفض الجنزوري وحكومته وأعلن حكومة بديلة في الميدان
المستفيد هو من رفض الانتخابات وإعتصم في الميدان
المستفيد هو من هاجم الداخلية وأمن الدولة وطالب بإسقاط الشرطة
المستفيد هو من خطط للفتنة وتقسيم مصر
المستفيد هو من يحاكم ومن فقد شيئا في ثورة شعب حقيقية
ومن الخاسر
الخاسر هو وزارة الداخلية والشرطة وزير الداخلية الذي يطالب مجلس الشعب بمحاكمته
الخاسر هو المجلس العسكري الذي ظهر في موقف ضعيف وغير حاسم والذي يطالب البعض بتركه للسلطة
وما هو موقف الإعلام وفضائيات الحظيرة كما تقول يا محمد برجيس
هو إتهام الخاسر وتبرئة المستفيد وهذه مهزلة تفكير رهيبة ولكنهم يعاملوا الشعب على إنه مجموعة من الأغبياء
وإلى لقاء فهذه مقدمة

اسماعيل الناطور
02-04-2012, 01:07 PM
الأخوان إسماعيل الناطور محمد برجيس أشكركما على طرح هذه التساؤلات والهواجس التي تراود الكثيرين منا وتلك القصة التاريخية المعروفة لمحاولة غزو التتار لمصر.. فدأب كل الغزاة والطغاة هو محاولة نشر الفرقة والانقسام بين ضحاياهم أعمالاً بالقاعدة المعروفة فرق تسد.
لكن بما أننا أيضا قارئين للتاريخ ولسنا حميراً.. كما يدعي البعض فالذي أفسد مخطط أولائك الغزاة هم الشباب أمثال (قطز) و(الظاهر بيبرس) و( جهاد) الذين إلتف حولهم الشعب المصري وكانوا قوة لا تقهر واستطاعوا أن ينتصروا على جيش جرار كالجراد ودحروه على أرض مصر بسلاح الإيمان والصبر والتلاحم بين كافة أطياف الشعب وقت المحن.. ففي مصر خير أجناد الأرض..ولا أعني هنا أبداً المجلس العسكري..!! لكن شعب مصر ..جيش مصر.. فكل شعب مصر جيش..وكل جيش مصر شعب..إلا بعض من باعوا ضمائرهم للشيطان و يقاتلون من أجل مصالحهم والبقاء على كراسيهم وعدم محاسبتهم وولائهم لأولائك الفسدة المفسدين الذين يسكن بعضهم السجون وأغلبهم مازال طليقاً يخطط ويدبر تلك المخططات التي تحدثت عنها..!!
أرانا نتفق كثيراً في الكثير من الأراء ومحبتنا لوطننا وخوفنا عليه لكن نختلف فقط في نقطة واحدة هي المجلس العسكري..حادثة بورسعيد مدبرة مئة بالمئة..و بتخطيط شيطاني وأيادي ليست خفية ولا خافية على أحد وإختيار محافظة بورسعيد لم يأت من قبيل الصدفة لتاريخها الطويل مع شغب الملاعب وليس ماتقوله عن مخططات التقسيم وإلا فالمخطط موجود منذ أيام المخلوع طيب الله ثراه وبشبش البطانة التي تحرسه..لكنه نفس المخطط الذي تحدث عنه ينفذ حتى في غيابه المؤقت بجسده.. أنا ومن بعدي الفوضى ويقولها المجلس العسكري ويقولها بشار وقالها من قبل القذافي وقالها عبدالله صالح..أنظر نفس اللغة ونفس المخطط الماسوني الصهيوني..!! إما أن يتم تركيع الشعب وإلا انطلق البلطجية وانتشرت السرقة والجريمة المنظمة التي تحدثت عنها وعمت الفوضى في كل مكان..!!
عندما يريد المجلس العسكري والشرطة تأمين الانتخابات كإستعراض للقوة يتم تأمينها على الفور في كافة أنحاء الجمهورية وعندما يحذرون من حدوث الفوضى والمجموعات المندسة تقع تلك الأحداث وكأنهم يعلمون بالتحديد أماكن وتواريخ وقوعها ولا يمنعونها برغم أن ذلك بأيديهم لكنه نوع من إظهار العين الحمراء وقرص الودان لأولائك الثوار الذين تجرؤوا على المجاهرة بالتطاول على أسيادهم سواء السابقين او القابعين في سدة الحكم ..وكأن إلغاء قانون الطوارئ هو السبب في ذلك الحادث في بور سعيد ..وأن المجلس العسكري حينما رفع يده عن التأمين حدث ما حدث فماذا لو ترك لحكومة مدنية أو رئيس منتخب أو مجلس الشعب مهمة تسير البلاد..؟!
ألست معي أن حادثة بورسعيد كان يمكن منعها وتأمين المباراة بصورة مثل التي حدثت في مباراة المحلة..؟! ألم تكن تشكيلات الأمن المركزي تستطيع الفصل بين الجمهورين ومنع تلك التجاوزات التي حدثت قبل المباراة وعدم السماح بدخول الشماريخ والعصى والأسلحة البيضاء..؟! ألم تكن تستطيع حتى إلغاء المباراة أو نقلها أو لعبها من دون جمهور..؟!
إذاً من المدبر لكل هذا يا صديقي من يملك كل هذه الصلاحيات في البلد..؟! من المسؤول عن المحافظة على الأمن ..؟! من لديه اجهزة المخابرات والأمن الوقائي والأمن الوطني والشرطة المدنية والعسكرية والأمن المركزي..؟!
أري في قصتك التاريخية أن المجلس العسكري هو نفسه (شجرة الدر) التي ماتت بالقباقيب والتي قفزت على السلطة في ظروف مشابهة بعد وفاة السلطان (الصالح نجم الدين أيوب) أثناء معركة المنصورة وحكمت مصر لمدة قصيرة..وكادت العديد من المكائد كي يستتب لها أمر الحكم وحاولت مزاوجة السلطة لكنها تخلصت من زوجها ( أيبك) حينما وجدت أنه سيستأثر بالسلطة ويقوم بعزلها عن الحكم مثلما يحدث الآن مع الثوار الممثل الشرعي لثورة 25يناير والحاكم الشرعي لمصر والذي خرج من رحمه أول مجلس شعب بانتخابات حره ..و سيولد أيضا أول رئيس جمهورية حر.. ليس مسخاً من مسوخ المجلس العسكري - عفوا- (شجرة الدر) التي كانت على الاستعداد أن تتزوج بـ(أقطاي) أيضاً أو أي رجل آخر كي يعينها على البقاء تحكم حتى ولو من وراء الكواليس..!!
أشكرك على هذه المقارنة التاريخية التي أوضحت الصورة جلية و على كل لبيب أن يرى أي السيناريوهين أقرب إلى قلبه و عقله
فالحلال بين و الحرام بين و بينهما أمور مشبهات فاستفت قلبك.

[center]
وإنقسمت فلسطين إلى خمس دول







الأخ الدكتور اشرف
أرآك قد لونت هذه الفقرة بلون آخر ...
لذلك سأشرحها
1- دولة اسرائيل
2-دولة الأردن
3-اراضي حكومة عباس - الضفة
4-أراضي حكومة هنية -غزة
5- مجموع الشتات الفلسطيني ويتزعمه منظمة التحرير الفلسطينية التي لا قائد لها
ولي عودة للرد على مشاركتك

اسماعيل الناطور
02-04-2012, 01:12 PM
تحياتى البيضاء

أستاذ إسماعيل ، هذى المرة أعذرنى سأتكلم معك بصراحة لم أتكلم بها معك من قبل ، رغما أنى أشعر أنى أضع من نفسى كثيرا عندما أتكلم مع إنسان مريض مثلك لكن ما باليد حيلة ها أنت تجر ذيلك راجعا للمنتدى مرة أخرى ، أستاذ إسماعيل فى يقينى أن كارهى مصر والمصريين من أمثالك والذين يستترون بجلد نظرية المؤامرة لابد لهم بالطبع من هذا النباح حول المؤامرة التى تحاول أن تظهر الشعب المصرى شعبا مغررا بها ساذجا حميرا –كما تحب أن تصف الناس - يغرر بهم مجموعة شباب ، والحقيقة أن الثورية المصرية غصبا عن أمثالك وكارهى مصر ستظل ربيعا حقيقيا وكان مقدرا لها أن تحدث والسؤال فى مصر لم يكن أبدا هل ستحدث الثورة ؟ وإنما متى ستحدث ؟ والثورة المصرية بدأت بشائرها جلية واضحة قبل الثورة العظيمة بسنوات طوال ، وما حدث فى بورسعيد ليس كما يصوره لك عقلك المريض أنه من تدبير أمريكا والماسون ، إنما هى خطة من الداخلية المصرية لمد قانون الطوارىء وإعادة تاريخ القهر كان جليا فيها التخاذل وجلب البلطجية وغيرها من الإشارات الواضحة التى ربما تخفى على أمثالك من المغرضين ، وهى خطة ستبوء بالفشل وستنفضح أو قد انفضحت ، فهون على نفسك أيها الكاره المريض ، مصر ستجتاز هذى الفترة الانتقالية بخيرها وشرها ، مصر دولة عظيمة لن يؤثر فيها نعيقك فاسترح

ختاما لقد حذفت بعضا من البذاءات التى قرأتها هنا عن وصفك للناس بالماسون والشذوذ وغيرها من سفالات لا تليق بمنتدى كهذا المنتدى
الأستاذ المحترم محمد الصاوي
الأساتذة الأعزاء فريق الإدارة والإشراف
السلام عليكم
اتفقنا سابقا على أنه في حالة وجود مواضيع أو ردود تحمل إساءات أو ألفاظا فجة فإنه يتم حذف الموضوع كله أو المشاركة حذفا بسيطا كإجراء مؤقت نقوم بمراجعته في حال شكوى المتضرر .. ولكن دون تحرير المشاركة أو حذف جزء منها لأنه بذلك يختفي جسم الجريمة ولايمكننا الفصل في الشكوى .. لذلك كله رجاء الحذف البسيط للمشاركة وعدم تحرير المشاركة نهائيا حفظا للحقوق وضمانا لحيادية هيئة الإشراف .
تحياتي لكم

الأستاذ المحترم محمد الصاوي
الأساتذة الأعزاء فريق الإدارة والإشراف
السلام عليكم
اتفقنا سابقا على أنه في حالة وجود مواضيع أو ردود تحمل إساءات أو ألفاظا فجة فإنه يتم حذف الموضوع كله أو المشاركة حذفا بسيطا كإجراء مؤقت نقوم بمراجعته في حال شكوى المتضرر .. ولكن دون تحرير المشاركة أو حذف جزء منها لأنه بذلك يختفي جسم الجريمة ولايمكننا الفصل في الشكوى .. لذلك كله رجاء الحذف البسيط للمشاركة وعدم تحرير المشاركة نهائيا حفظا للحقوق وضمانا لحيادية هيئة الإشراف .
تحياتي لكم

تحياتى البيضاء


ختاما لقد حذفت بعضا من البذاءات التى قرأتها هنا عن وصفك للناس بالماسون والشذوذ وغيرها من سفالات لا تليق بمنتدى كهذا المنتدى

أعتقد إني راجعت الموضوع , فلم أجد شيئا محذوفا منه , لذلك أجدها إفتعال أو مشروع ثائر كمن نراهم هذه الأيام , ولكن لن أفوتها فرصة لشكرك على أضافة مشاركة لموضوعي ,,,,,,كل عام وأنت غبي
الأستاذ المحترم محمد الصاوي
الأساتذة الأعزاء فريق الإدارة والإشراف
السلام عليكم
اتفقنا سابقا على أنه في حالة وجود مواضيع أو ردود تحمل إساءات أو ألفاظا فجة فإنه يتم حذف الموضوع كله أو المشاركة حذفا بسيطا كإجراء مؤقت نقوم بمراجعته في حال شكوى المتضرر .. ولكن دون تحرير المشاركة أو حذف جزء منها لأنه بذلك يختفي جسم الجريمة ولايمكننا الفصل في الشكوى .. لذلك كله رجاء الحذف البسيط للمشاركة وعدم تحرير المشاركة نهائيا حفظا للحقوق وضمانا لحيادية هيئة الإشراف .
تحياتي لكم

الأخ العميد ....الحمد لله على السلامة بصفتك من أبناء بورسعيد , بورسعيد وبطولة العدوان الثلاثي على مصر , يريد البعض تشويهها بهذه المذبحة المفتعلة .....قسما إن الحق لواضح والنصر قادم والحقيقة الكاملة تقترب من أذهان الثوار الحقيقيين الذين خرجوا في الخامس والعشرين من يناير ليصححوا قطار مصر من حصار رفح لفتح معبر رفح وكسر الحصار , هؤلاء الذين قمعوا الظلم والفساد لمبارك الذي أنساه البعض شرفه العسكري

اسماعيل الناطور
02-04-2012, 01:34 PM
أخرج عن وهمك يا سيد إسماعيل واستيقظ من سباتك العميق ، ولا يغرنك كثرة المهللين لك ، ولا كثرة الإضطرابات التي تعقب الثورات .
فجمهورية الفوضى التي تزعم أنها ستبدأ هي في طريفها إلى زوال ، وما يحدث في الشارع المصري من إنفلاتات ومن هرج ومرج ، ما هو إلا العلامة المضيئة لزوال الفوضى والقضاء على كلابها .
أراهنك ما دمت تعشق المراهنات ، أن ما حدث ببور سعيد هو آخر الفوضى وهو نهايتها بأذن الله تعالى ، وهو آخر الأوراق التي لعب بها الخونة والمتآمرون من القابعين خلف سجن طرة وقائدهم في المركز الطبي العالمي ومن معهم من أبناء مبارك وجماعة آسفين يا ريس .
ستسترد مصر عافيتها وستعود إلى أمجادها عما قريب ، و لست في ذلك واهما كوهمك ، أو نائما كنومك ، ولكن أرى ما لاتراه ، والحر يرى الحرية ، وغيره يرى الفوضى .
ألا فانظر منصفا إلى بعض هذه الأمجاد التي حققتها الثورة .
أما رأيت الإنتخابات الحرة يخوضها الشعب لأول مرة في تاريخه بلا تدخل من حكومة فاسدة ؟
أما رأيت مجلس الشعب وهو يحاسب رئيس الحكومة ووزير داخليتها حساب القاضي للمتهمين ، وهما في قفص الإتهام لا يحاران جوابا ؟!
أما رأيت الأزهر يعود إلى عهده ، وإلى منارته المشرقة للأمة الإسلامية والعربية ؟
أما رأيت المليونيات تقض مضاجع الحكام وتؤرقهم ليلا ونهارا ؟
أما رأيت البيانات تتوالى تحاول ترضية الشعب المصري وتحاول الإستجابة لمطالبه ؟
أما رأيت الحكومات تسقط واحدة تلو الأخرى كلما جاءت حكومة لا تلبي رغبات الشعب سقطت فأعقبتها أخرى ؟
أما رايت الملك الإله في القفص راقدا كجاموس أخرس ، ومعه ولديه يستأذن أحدهما من السجان ليقضي حاجته ، وما أدراك ما حاجته ؟
أما رأيت العادلي ورجاله وكل وزراء مصر المنهوبة يحاكمون ويحاسبون ما لم يحدث في أي بقعة من بقاع الأرض من قبل ولا من بعد ؟
أما رأيت الشعب وقد خرج من قمقمه إلى فساحات الحرية ورحابتها يعلن عن رأيه بلا خوف ولا رعب ؟
أما رأيت مؤسسات القهر والقمع تساقطت وهوى رجالها الذين كان يملئون السمع والبصر ويبثون الرعب في القلوب إلى الأرض أذلة ؟
وأما وأما وأما كثير وكثير ، ولكنك لا ترى إلا ما يراه محبي الجلادين وعاشقي الملوك وهواة الحكام ومقدسي الرؤساء ، حتى يبكون الان ويتباكون على يوم من أيام مبارك بحجة الفوضى والإنفلاتات .
لقد خسرت في راهنك يا رجل ، وستخسر راهنك الأكبر عندما يسقط عما قريب الصنم الذي ترونه لا يسقط في الشام .
سيسقط بأذن الله ، و سيدفع ثمن الدماء التي تراق كل يوم على أرض سوريا ، وستكون أنت في موقف محرج ، كما أراك الآن ، وأنت تضع توقيعا يقول أن أبناء مصر آسفين .
لا يا أستاذنا العلم .
نحن لا نتأسف ، ونحن لا نندم ، ونحن لا نتمنى عودة النظام السابق أو شخوصه .
ولكننا نصبر ونحتسب ، ونرى المستقبل في ظل الحرية أفضل ، ونرى العدالة الإجتماعية تدق على الأبواب ، ونرى الفوضى إلى زوال .
تأسف وحدك أو كن من آسفين ياريس ودونك ميدان الموريستان ، أقصد العباسية .

أخرج عن وهمك يا سيد إسماعيل واستيقظ من سباتك العميق ، ولا يغرنك كثرة
لقد خسرت في راهنك يا رجل ، وستخسر راهنك الأكبر عندما يسقط عما قريب الصنم الذي ترونه لا يسقط في الشام .
سيسقط بأذن الله ، و سيدفع ثمن الدماء التي تراق كل يوم على أرض سوريا ، وستكون أنت في موقف محرج ، كما أراك الآن ، .
قبل أن أخرج عن وهمي إستاذ عبد العزيز
ممكن أن تشرح للقارئ ما هو رهاني السابق والذي خسرته
أما عن رهان جمهوريات الفوضى فأنا أقبله وأعود وأكرر ...إن لم تقف الشرطة والجيش بحزم لكل من يعتدي على رجال الشرطة والجيش فالفوضى قادمة لا محالة

اسماعيل الناطور
02-04-2012, 03:34 PM
المصيبة أتوقعها منذ سنوات منذ تقديم موضوع نظرية تسمين العجول ومخطط تقسيم المنطقة
المصيبة أتوقعها منذ أكثر من سبعة شهور منذ أن توافرت المعلومات عن خطة الثوارات الملونة والتمويل ومنظمة فريدم هاوس
المصيبة أتوقعها من حجم المعلومات المتواردة عن نوعية بعض من يقودوا هذه الثورات
المصيبة أتوقعها من مهزلة المليونيات دون سبب مقتع
المصيبة أتوقعها من حجم الاعلام والفضائيات والكذب والتلقين
المصيبة أتوقعها من حجم الضغط على مؤسسات الدولة كالشرطة والجيش والتي هي أجهزة تنقاد ولا تقود
المصيبة توقعتها من تصرف الجامعة العربية ومجلس الأمن الغير أخلاقي
لذلك قلت قبل أيام ....إنتظروا أياما وربما شهور وسنبكي إن لم نستيقظ
والآن نأتي إلى مجزرة بورسعيد والتي لا يمكن لأي عاقل إلا أن يقول إنها مدبرة ومدبرة بحكمة كما عودتنا المؤامرة منذ بدايتها والتي إعتمدت على مبدأ ...أن الفاعل والفعل يجب أن يتم بيد أهل البلد إن كان في مصر أو سوريا أو ليبيا أو اليمن
الفعل والفاعل يجب أن يكون من أهل البلد , حتى يمكن تقبل الجمهور لفكرة الثورة ويستبعد فكرة المؤامرة , وهنا يأتي الإعلام المدفوع الأجر كالجزيرة أو كثير من الفضائيات المصرية والعربية , هنا يأتي دور الاعلام , تكبير الكذبة , وتصغير المصداقية , والتركيز على الأخطاء , وتصيد المواقف ....
نقول ما حدث في بورسعيد مؤامرة لا شك ورأس المؤامرة معروف وهو من قدم لنا هذا الربيع على إنه ربيع عربي وليس ربيع شيطاني ماسوني يشترك فيه المال وقوى السيطرة العالمية والغرب القبيح
ولكن من هو الفاعل ومن هي الآيادي الملطخة بالدماء ...لذلك سنعود ونقرأ الحدث بهدوء
وسنقفز على النتائج وعلى طريقة التحقيق الجنالئ من المستفيد مما حدث ومن هو الخاسر مما حدث
المستفيد هو عمر عفيفي وكل من توعد وأعلن يسقط يسقط حكم العسكر
المستفيد هو من رفض الجنزوري وحكومته وأعلن حكومة بديلة في الميدان
المستفيد هو من رفض الانتخابات وإعتصم في الميدان
المستفيد هو من هاجم الداخلية وأمن الدولة وطالب بإسقاط الشرطة
المستفيد هو من خطط للفتنة وتقسيم مصر
المستفيد هو من يحاكم ومن فقد شيئا في ثورة شعب حقيقية
ومن الخاسر
الخاسر هو وزارة الداخلية والشرطة وزير الداخلية الذي يطالب مجلس الشعب بمحاكمته
الخاسر هو المجلس العسكري الذي ظهر في موقف ضعيف وغير حاسم والذي يطالب البعض بتركه للسلطة
وما هو موقف الإعلام وفضائيات الحظيرة كما تقول يا محمد برجيس
هو إتهام الخاسر وتبرئة المستفيد وهذه مهزلة تفكير رهيبة ولكنهم يعاملوا الشعب على إنه مجموعة من الأغبياء
وإلى لقاء فهذه مقدمة
والآن نبدأ المسيرة الشاقة على الفاعل الداخلي , وسنعتمد النقل تلك الطريقة الوحيدة التي أجدها لوضع مصداقية لما نظن أو نعتقد , فكما قلنا وفي عدة مواضيع سابقة , الدليل صعب على المتابع عن بعد , ولن نجد إلا مجموعة من القرائن قد ترقى يوما لتصنع فكرة أقرب للدليل من الظن أو الإعتقاد , من الواضح هنا أن هناك تقصيرا أمنيا من جهاز الشرطة وملحقاته من أجهزة البحث والإستقراء , لذلك يجب وضع التقصير في خانة الإتهام , ونستمر في البحث وراء التقصير ...ونضع سؤالا إفتراضيا
هل التقصير هو تقصير جهاز أنهكته الطعنات أو تعمد تقصير من أفراد في الجهاز , وأعتقد أن هذا ما بدأت فيه النيابة العامة
"استمعت النيابة العامة، الخميس ، لأقوال كل من مدير الأمن ونائبه وقائد الأمن المركزى ومدير المباحث الجنائية ومدير أمن الاستاد، وجار الاستماع لأقوال كل من محافظ بورسعيد ومديرى النادى المصرى وأفراد الأمن والعاملين ومراقبى المباراة وطاقم التحكيم والمسؤولين باتحاد كرة القدم والمجلس القومى للرياضة. وقررت النيابة احتجاز كل من خضعوا للاستجواب على ذمة التحقيقات، ووجهت لهم النيابة اتهامات بالتقصير والإهمال فى تأمين المباراة والتسبب فى وفاة 71 مواطناً وإصابة أكثر من 400 آخرين. وقررت النيابة العامة استدعاء سمير زاهر، رئيس اتحاد الكرة، وعماد البنانى، رئيس المجلس القومى للرياضة، لسؤالهما فى الأحداث."

إذن التقصير كان المتهم الأول وقد بدأ التحقيق الفعلي معه
فمن هو المتهم الثاني قبل أن نبدأ في البحث عن الفاعلين

اسماعيل الناطور
02-04-2012, 03:51 PM
المتهم الثاني الإستفزاز
بلد البالة ماجبتش رجاله
فمن وضع هذه اليافطة وبهذا الحجم أراد أن يستفز كل رجل من بورسعيد فما بالك بمشجعي كرة قدم صغار السن وقد يكون الوعي بينهم بعيدا عن مخطط وهدف من كان وراء تلك اليافطة , طبعا هذا جزء من الاستفزاز وإثارة الجماهير والذي لدينا عليه دليل وبالتأكيد هناك من الألفاظ المرافقة على الواقع ما هو أكثر وأعتقد أن هذا سر مشاركة بعد الجماهير بالنزول للملعب دون أن تدري أن هناك عدد من القتلة ينتظرون بينهم للإختباء والتخفي بينهم
http://nemsawy.com/arab/wp-content/uploads/2012/02/2958.jpg
بلد البالة ماجبتش رجاله

اسماعيل الناطور
02-04-2012, 04:03 PM
http://www.youtube.com/watch?v=e-4k3nE-I9I

اسماعيل الناطور
02-04-2012, 06:10 PM
والآن نبدأ المسيرة الشاقة على الفاعل الداخلي , وسنعتمد النقل تلك الطريقة الوحيدة التي أجدها لوضع مصداقية لما نظن أو نعتقد , فكما قلنا وفي عدة مواضيع سابقة , الدليل صعب على المتابع عن بعد , ولن نجد إلا مجموعة من القرائن قد ترقى يوما لتصنع فكرة أقرب للدليل من الظن أو الإعتقاد , من الواضح هنا أن هناك تقصيرا أمنيا من جهاز الشرطة وملحقاته من أجهزة البحث والإستقراء , لذلك يجب وضع التقصير في خانة الإتهام , ونستمر في البحث وراء التقصير ...ونضع سؤالا إفتراضيا
هل التقصير هو تقصير جهاز أنهكته الطعنات أو تعمد تقصير من أفراد في الجهاز , وأعتقد أن هذا ما بدأت فيه النيابة العامة
"استمعت النيابة العامة، الخميس ، لأقوال كل من مدير الأمن ونائبه وقائد الأمن المركزى ومدير المباحث الجنائية ومدير أمن الاستاد، وجار الاستماع لأقوال كل من محافظ بورسعيد ومديرى النادى المصرى وأفراد الأمن والعاملين ومراقبى المباراة وطاقم التحكيم والمسؤولين باتحاد كرة القدم والمجلس القومى للرياضة. وقررت النيابة احتجاز كل من خضعوا للاستجواب على ذمة التحقيقات، ووجهت لهم النيابة اتهامات بالتقصير والإهمال فى تأمين المباراة والتسبب فى وفاة 71 مواطناً وإصابة أكثر من 400 آخرين. وقررت النيابة العامة استدعاء سمير زاهر، رئيس اتحاد الكرة، وعماد البنانى، رئيس المجلس القومى للرياضة، لسؤالهما فى الأحداث."

إذن التقصير كان المتهم الأول وقد بدأ التحقيق الفعلي معه
فمن هو المتهم الثاني قبل أن نبدأ في البحث عن الفاعلين

مساعد وزير الداخلية يروي "للبرلمان" كواليس مذبحة بورسعيد بداية من شد الجزرة وانتهاء باللافتة المسيئة
اللواء أحمد جمال الدينأكد اللواء أحمد جمال الدين مساعد أول وزير الداخلية أن الأمن لن يتحقق فى مصر بجهود الشرطة فقط وأن كل مواطن مسئول عن أمن هذا البلد الذى يمر بمرحلة خطيرة.

وقال جمال الدين فى بيان له أمام الاجتماع العاجل الذى عقدته لجنة الدفاع والأمن القومى بمجلس الشعب اليوم (السبت) لمناقشة أحداث الداخلية و بورسعيد أن هناك دولا حول مصر وعلى مستوى العالم لها مصالح فى مصر لاترغب ان تقف مصر على قدميها.

ووجه اللواء أحمد جمال الدين مساعد أول وزير الداخلية عزاء الوزارة لأسر الضحايا فى الأحداث المؤسفة فى بورسعيد متمنيا الشفاء لكل المصابين .

وقال إنه منذ ثورة 25 يناير الشرطة كانت مستهدفة وقد يكون نتيجة أخطاء رسخت صورة على المستوى العام وحصلت عداوة مع الشعب كان نتيجتها هروب 23 ألف سجين وسرقة أكثر من 16 ألف قطعة سلاح من الشرطة، فضلا عن الإحباط الذى ألم بقطاع كبير من الضباط والأفراد، إلا أن الشرطة بدأت تمسك بزمام الأمور من جديد وترفع المعنويات بين الضباط والأفراد وتعدل فى الخطط وتحدد الأولويات ومع كل يوم كان الأمن يتحقق ويتحسن إلى الأفضل.

أضاف جمال الدين أن الأمن لن يتحقق بجهود الشرطة فقط لأن الأمن منظومة متكاملة الكل له دور فيها، مؤكدا أن مصر تمر بمرحلة خطيرة وأن هناك دولا حولنا وعلى مستوى العالم ولها مصالح فى مصر لاتريد لها الاستقرار ولا لمصر أن تقف على قدميها.

قال اللواء أحمد جمال مساعد أول وزير الداخلية أمام الاجتماع الطارىء للجنة الدفاع والأمن القومى بمجلس الشعب، إن مصر مستهدفة وكلنا ندرك ذلك وهناك عدم استقرار سياسي. الأمر الذى ينعكس على الأمن والمجتمع.

وأضاف أن مصر الآن فريقان الأول يريد الأمن والأمان وأن يعمل ويعيش فى هدوء واستقرار والثانى له مصالح سياسية يرغب فى تحقيقها ولا يهمه استقرار البلد .

وأكد أن جهاز الشرطة مؤمن برسالته وفى كل موقع الكثير من شرفاء الشرطة يعملون لأمن هذا البلد ومخلصون ويقدمون أرواحهم فداء للوطن وآخرهم رئيس مباحث صدفا.

وأشار إلى أنه طلب منذ ستة أشهر مدرعات لمكافحة الجريمة ولم نتلق ردا حتى الآن وهناك من الدول من رفض بيع هذه المدرعات لمصر.

وقال إن الاعلام عليه دور أساسى فى أمن هذا البلد ..وتساءل لمصلحة من يرسل الاعلام رسالة إحباط باستمرار للضباط والأفراد.

كشف اللواء أحمد جمال الدين مساعد أول وزير الداخلية أنه منذ شهر فبراير من العام الماضى بلغ عدد الوقفات الاحتجاجية 710 وقفات وأن الشرطة لاتواجه هذه الوقفات أو المظاهرات السلمية أبدا. كما اعلن اللواء محمد ابراهيم يوسف وزير الداخلية منذ اليوم الأول لتوليه المسئولية وأن الداخلية غيرت سياستها بالفعل .

أضاف جمال الدين ربما يكون هناك تقصير ولكن ماذا حدث لقد انتقل النائب العام وهو أعلى سلطة تحقيق فى البلد ومعه فريق من المحققين إلى بورسعيد وشكل مجلس الشعب لجنة تقصى حقائق ووزير الداخلية اتهم فى مجلس الشعب بالتقصير وهذه أول مرة فى تاريخ مصر.

وتطرق اللواء أحمد جمال الدين مساعد أول وزير الداخلية لاحداث بورسعيد.. وقال أنه منذ 26 يناير ومدير أمن بورسعيد يراجع عمليات التأمين للجمهور الذى سيحضر بالقطار أو بغيره، مشيرا إلى أنه قبل وصول القطار إلى بورسعيد بعشرة كيلومترات قام أحد الركاب بشد جزرة القطار الذى توقف فى منطقة "الكاب" وقام الركاب بجمع زلط وحجارة واستقلوا أوتوبيسات وتوجهوا لملعب المباراة.

وقال إن المباراة كانت مؤمنة بـ 17 تشكيلا من الأمن المركزى وفى العادى تؤمن بـ 7 تشكيلات فقط وعقب المباراة تم الدفع بـ 3 تشكيلات جديدة، مشيرا إلى أن الضباط والأفراد تعرضوا لاهانات بالغة من الجماهير، ما أدى إلى حالة من الاحتقان والتذمر بين الأفراد لدرجة رفضهم تنفيذ أوامر الضباط .

إنتهى نقل الخبر
إلا أن ما يستدعي الكتابة هنا ....أن الجزيرة قد قطعت نقل الحديث عندما ذكر اللواء أن جنود الأمن المركزي قد تعرضوا لكثير من الاهانة مثل رمي أكياس مملوءة بالبول عليهم بدون مبرر , وأتمنى أن ينقل أحدهم الفيديو الكامل لأن هناك الكثير من التفاصيل التي لم يذكرها هذا النقل

اسماعيل الناطور
02-04-2012, 09:30 PM
المتهم الثالث الوعي ومدى وعي الشباب بالتمييز بين الوطن والحكومة فلقد أنتج نظام مبارك جيلا من الشباب لا يفهم معنى الانتماء ومعنى الحقوق ومعنى الحرية فالمنشآت العامة من متاحف ومباني الحكومة والمعدات والشوارع كل الممتلكات العامة هي ملك الشعب وليس ملك الحاكم ولا الحكومة , الخصومة فقط يجب أن تكون مع الحاكم كشخص أو الحكومة كأشخاص أما الحرق والتكسير والتعدي على الأخ المواطن وإنهاء حياته أو سلبه ما يملك هو بعيد جدا عن مفهوم الثورة والثوار , فالثائر هو من يضع روحه في مقدمة الأرواح لتحقيق حلم عامة الشعب , وليس الثائر ولن يكون أبدا من الثوار من يعتدي على ممتلكات الوطن أو أرواح أخوته , أو يعتدي على المسلمات الإجتماعية من إحترام الكبير والحنان على الأصغر , أو التعدي على ما إتفق عليه الوطن من مسلمات أو أديان أو تشريعات , ولكن فساد نظام مبارك وإنتاجه لملايين من قاطني المقابر والعشوائيات وأولاد الشوارع مكن المؤامرة من أن تجد جيشا من المجردين من الانتماء وهم ملك يمين من يدفع لهم أكثر , فكانت البلطجية يد الفاعل الذي يدفع ويحرض عن بعد...وهنا آن الأوان لنسأل ....ومن هو الفاعل ؟

اسماعيل الناطور
02-04-2012, 10:55 PM
أخي الكريم اسماعيل المحترم
مساء الخير
أتمنى من كل من يحبّ السياسة أن يتتلّمذ في مدرستك التي ترى بعين فاحصة كل ما يمكن أن يحدث في المستقبل ، سواء أكان إيجابيا أم سلبيا !!!!!!!! .
وأنا أول تلميذ أضع نفسي في مدرستك الخبيرة والاستراتيجية والأريبة بكل ما تحوي الكلمة من معنى .
لقد أذكرتني نقاشا جرى في الغرفة الصوتية بعد نجاح الثورة في مصر الحبيبة ، فسألت الاخ الموجي :
( هل تعتبر أن الثورات التي قامت في تونس وليبيا ( إذا اعتبرناها ثورة ) ثم مصر ) قدنجحت ؟؟؟؟؟؟؟ ) فقال الأخ الغالي أنها تنتظرها مفاجآت كثير ة ، وأرجو أن لا يحسن الظن الأخوات والإخوة بهذه الثورات كثيرا ، طالما أنها ليست بعيدة عن أطماع قوى الشر في العالم ،
حمى الله وطننا العربي من كل سوء .
وهاهي قوى الشر من العربان والغربان تسقط بالضربة القاضية في مجلس الأمن ، سمها كما شئت ولكن المهم ان مقولة القطب الواحد ولّت وانتهت والحمد لله ، لا أستطيع أن أنكر أنه يوجد أخطاء وهذا شيء بدهي في كل بقعة من العالم وفي كل البشر ، فالكمال لله وحده - جلّ وعلا - ، ولكن الحوار هو الحل وليس بسفك الدم الغالي . رحم الله أموات جميع العرب .
ننتظرك في ملتقى النثر منذ زمن !!!!!!!!!! .
تحياتي وودي لك

أخي غسان
علمتنا قسوة ترك الوطن والحرمان من دفء المواطنة , حب الأوطان والتقديم النصيحة لمن ما زال لا يفهم معنى قسوة ضياع الوطن , وعلمنا إسلامنا الحق أن الأمر بالمعروف والنهي عن المنكر من واجبات المسلم , وعلمنا رسولنا محمدا صلى الله عليه وسلم , أن المؤمن القوي خير من المؤمن الضعيف , وأن من وجد منكرا فليقاومه , لذلك نقاوم هذه الهجمة على الأوطان , كما كنا نقاوم دائما كل من تحكم وتجبر بخلق الله دون حق , هي كلمة لا نريد منها إلا وجه الله وراحة الضمير , حتى في بعض العبارات التي يراها البعض قاسية , فما وضعتها إلا لتعطي المدلول الذي يجذب العقل للتفكير , ومع شكري وتقديري لمشاركتك , أدعو الله أن ينير بصيرتنا ويفتح عقولنا للحق وللحق فقط

اسماعيل الناطور
02-06-2012, 10:30 AM
http://www.youtube.com/watch?v=uOzgcUy6NnU
وأقر وزير الداخلية بوجود تقصير من قوات الأمن المركزي في أداء واجبها بتأمين الحماية خلال مباراة الأهلي والمصري مشيراً لأنهم لم يقطعوا بشكل عرضي الملعب للفصل بين الجمهورين لمنع الاحتكاكات كما حدث خلال مباراة المحلة والأهلي ، لكنه عاد ليؤكد على صعوبة وقوفهم أمام هذا العدد الضخم من جماهير المصري التي اندفعت إلى أرض الملعب.

وأشار اللواء محمد إبراهيم لأنه يحق لمدير الأمن أن يلجأ لوزارة الداخلية لطلب تعزيزات ولكن مدير أمن بورسعيد اللواء عصام سمك لم يطلب أي إمدادات إضافية كما لم يشر لوجود إحتكاكات أو مشاحنات تتطلب تأجيل أو نقل المباراة مشدداً على أن مدير أمن بورسعيد تم إختياره بعد مراجعة ملفه جيداً ، نافياً بحسم الإتهامات الموجهة له بالتخاذل عن تأمين اللقاء بالشكل المطلوب موضحاً بأنه لم يكن ليرفض طلب تأجيل أو حتى إلغاء المباراة في أي توقيت لو طلب مدير الأمن ذلك مستشهدا ً بتأجيل مباراة الإتحاد السكندري مع حرس الحدود بناء على طلب مدير أمن الإسكندرية.

اسماعيل الناطور
02-06-2012, 08:51 PM
المتهم الثالث الوعيولكن فساد نظام مبارك وإنتاجه لملايين من قاطني المقابر والعشوائيات وأولاد الشوارع مكن المؤامرة من أن تجد جيشا من المجردين من الانتماء وهم ملك يمين من يدفع لهم أكثر , فكانت البلطجية يد الفاعل الذي يدفع ويحرض عن بعد...وهنا آن الأوان لنسأل ....ومن هو الفاعل ؟
بعد الإستماع لعدد من الحضور من شباب مشجعي الأهلي على عدد من الفضائيات وإصرارهم أن من هاجموهم يرتدون ملابس مشجعي المصري
وبعد الإستماع لعدد من أهالي بورسعيد على عدد من الفضائيات وإصرارهم على أن من حمى جمهور الأهلى هم شباب بورسعيد
وبعد المظاهرات التي عمت بورسعيد ونداء بورسعيد بريئة
وبعد الإستماع لأغنية أطلقها أحدهم على إحدى مواقع الفيس بوك تهدد بقتل مشجعي الأهلي
وبعد الإستماع للشريط الذي نقله الأخ محمد برجيس لأحد البلطجية وذكره لأسماء معينة من رجال الأعمال الهاربين
وبعد إعتراف وزير الداخلية بالتقصير
نتصور أن الأمر في غاية الجدية , وأن الفاعل قوى ويمتلك من المعلومات والمال ما يكفي لتنفيذ هذا المخطط والذي يهدف إلى عدة أهداف وأهمها الفوضى وآخرها حصار بورسعيد تمهيدا لحدث أكبر من ذلك , إذن الفاعل يجب أن يكون متعدد الرؤوس , فإذا كان العفيفي ضابط شرطة , فلماذا لا يكون هناك ضابط شرطة آخر لا زال يعمل بدون ضمير
وإذا كانوا الأناركين قد تواجدوا في الميدان , فلماذا لا يكونوا قد تواجدوا في الملعب
وإذا كان رجال الأعمال في سجن طرة , فلماذا لا يكون منهم من ما زال طليقا , أو أن موظفيهم ما زالوا طلقاء ويتقاضون الرواتب ويبحثون عن خلاص أسيادهم
وإذا كان البرادعي وفريدم هاوس ومن لف لفهم وقد فشلوا في الوصول إلى الحكم , فلماذا لا يبحثون عن أي طريقة لتنفيذ شعار يسقط يسقط حكم العسكر
وما دام الفاعل متعدد الرؤوس ,,,,فلم يبقى أمامنا إلا القبض على كل بلطحي شارك في القتل , ومنهم نسلط الضوء على الفاعلين الذين هم خدم الفاعل الرئيس القادم من وراء الحدود
http://www.youtube.com/watch?v=zWFBfVO9GJo
إذن لنفرغ هذا الشريط ونبدأ البحث من هذه النقطة

اسماعيل الناطور
02-06-2012, 11:32 PM
وأخيرا موضوعنا والذي بدأناه بعنوان الوجه الماسوني للثورة وصل إلى من يهمه الأمر ...القناة الفضائية الأولى المصرية الحكومية تناقش الليلة مخطط الفوضى وتقسيم مصر

اسماعيل الناطور
02-07-2012, 10:32 AM
بينهم أمريكيون وألمان وصرب.. المصريون تنشر أسماء المتهمين فى قضية التمويل الأجنبى


كتب ـ فتحى عبد النعيم | 06-02-2012 18:17

حصلت "المصريون" على قائمة بأسماء 43 متهمًا كان المستشار أشرف العشماوى، قاضى التحقيقات المنتدب من وزارة العدل للتحقيق قد قرر أمس الأول إحالتهم إلى محكمة الجنايات فى قضية التمويل الأجنبى للمنظمات والجمعيات المدنية منهم مصريون وأمريكيون وألمان ولبنانيون وصربيون وأردنى إلى محكمة الجنايات.

وتضم قائمة المتهمين 14 شخصًا من العاملين بالمعهد الجمهورى وهم: صمويل آدم أمريكى الجنسية وهو نجل وزير النقل الأمريكى الحالى، شرين سيهانى مديرة فرع المعهد فى مصر، كريستيان أنمل مديرة فرع الإسكندرية، سورت تشيك مديرة فرع أسيوط، هانز هولترث مدير فرع الأقصر، جون جورج مدير تدريب الأحزاب السياسية، ريدا خضر (فلسطينية) مسئولة البرامج بالمعهد الجمهورى، أسامة غريزى (أمريكى) مساعد مدير البرامج السياسية، سانيا مارك (أمريكية) المدير المالى، إليزابيث كيجين مسئولة البرامج السياسية، أحمد شوقى وأحمد عبد العزيز وأحمد آدم وعصام برعى وهم مديرون إداريون للمنظمة.

كما تضم القضية 15 متهمًا من العاملين بالمعهد الديمقراطى وهم: جولين هويوز (أمريكية) مقيمة فى مصر، أكادين تورتوفيتش (صربى) مدير فرع أسيوط، بوميدير (صربى) مدير فرع الإسكندرية، ليلى جعفر (أمريكية من أصل سورى) نائب المدير العام، روبرت بيكر (أمريكى) مدير الأحزاب السياسية، مارينا توفافيتش (صربية) مديرة الأحزاب السياسية على مستوى الجمهورية، ستيبى لين هاج (أمريكية) مديرة البرامج دانا دياكونوا (أمريكية) مسئولة التدريب، على حاج سليمان (لبنانى) مايكل جيمس سارون (أمريكى) مسئول الدعم لضمان التدريب، مارون صافير (لبنانى) مسئول الدعم لضمان التدريب، محمد أشرف عمر، مساعد البرامج السياسية، روان سعيد على، مسئولة برامج الأفراد، حفصة ماهر وأمجد مرسى (مصريان) مساعدا مدير مكتب أسيوط.

وتضم القضية أيضًا متهمين من منظمة فريدوم هاوس: تشارلز دان (أمريكى) المدير الإقليمى ، شريف أحمد صبحى (أمريكى من أصل مصرى) مدير برامج المنظمة فى مصر والشرق الأوسط، سمير سليم دراج (أردنى) مسئول عن المنظمة فى شمال إفريقيا، محمد عبد العزيز منسق البرامج فى مكتب مصر، نانسى جمال عقيل مديرة مكتب القاهرة، باسم محمد على مسئول البرامج السياسية، مجدى محرم مسئول الشئون المالية.

بالإضافة إلى متهمين من المركز الدولى الأمريكى للصحفيين (منظمة أمريكية) باتريك باتريل (أمريكى) نائب المدير العام، سانتا تانيس مسئول تطوير البرامج فى الشرق الأوسط، ميرا ناسيل مسئولة إدارة البرامج، يحيى زكريا على، مدير فرع المكتب فى مصر، إسلام شاهين المسئول المالى.

ومن بين المتهمين من العاملين منظمة كونراد الألمانية: أندرياس ياكوبى (ألمانى) مدير المنظمة لفرع المهندسين، كريستيان بارى ألمانى الجنسية) المدير المالى للمنظمة فى مصر.

ويواجه المذكورون اتهامات بتأسيس وإدارة فروع لمنظمات دولية على الأراضى المصرية، بغير ترخيص من الحكومة المصرية، بالمخالفة لقانون تأسيس وإدارة منظمات المجتمع المدنى.

وتنفيذ برامج تدريب سياسى لأحزاب، وإجراء بحوث استعلام، واستطلاع على عينات عشوائية من المواطنين، ودعم حملات انتخابية لأحزاب سياسية وحشد ناخبيهم فى الانتخابات البرلمانية، بغير ترخيص وإعداد تقارير لهذا النشاط وإرسالها لرئيس المنظمة بالولايات المتحدة الأمريكية.

وتمويل أشخاص أجانب غير مصريين، تسلموا وقبلوا أموالا على شكل دعم من منظمة دولية على حساباتهم البنكية، ومن خلال شركات تحويل الأموال وبطاقات ائتمان خاصة متصلة بحسابات بنكية خارج مصر فى سبيل ممارسة النشاط الذى أخل بسيادة الدولة المصرية.

وبلغ حجم التمويل ـ بحسب قرار الاتهام ـ خلال أربعة أشهر ملايين الدولارات ، موزعة كالتالى: المعهد الجمهورى 12 مليون دولار، المعهد الديمقراطى 18 مليون دولار، فريدوم هاوس 5 ملايين دولار، المركز الدولى الأمريكى للصحفيين (منظمة أمريكية) 3 ملايين دولار، منظمة كونراد (منظمة ألمانية)1،600000 مليون يورو.

اسماعيل الناطور
02-07-2012, 03:27 PM
http://www.youtube.com/watch?v=22yNpKmteSU&feature=player_embedded#!

الشاعر لطفي الياسيني
02-07-2012, 06:41 PM
السلام عليكم ورحمة الله وبركاته
تحية الاسلام
كلماتك ... كزخات الأمطار ...
تتساقط على أرض العذوبة ...
تروي الوجدان بزخات الصدق البريء ...
......فيغدو القلب منها حقلاً للمحبة ..
كلمات لها نعومة الندى ...
وعذوبته الصافية ...
يأتي حرفك العذب ..
ليصب في صحاري الإبداع المميزة ...
فتنهض من بين طياتها كل هذه الروعة ...
لروحك ولمشاعرك وردة غضة الغصن مني,,,
على هذا البوح والمشاعر المنطلقة عبر حرية القلم ..
وفكرك النير الذي نسج هذه العبارات الرائعة ..
وكم كنت بشوق لك ولحرفك اللامع النابض الناطق بالحق وللحق ...
دمت بألق وإبداع
الحاج لطفي الياسيني

اسماعيل الناطور
02-08-2012, 10:31 AM
المتهم الثالث الوعي ومدى وعي الشباب بالتمييز بين الوطن والحكومة فلقد أنتج نظام مبارك جيلا من الشباب لا يفهم معنى الانتماء ومعنى الحقوق ومعنى الحرية فالمنشآت العامة من متاحف ومباني الحكومة والمعدات والشوارع كل الممتلكات العامة هي ملك الشعب وليس ملك الحاكم ولا الحكومة , الخصومة فقط يجب أن تكون مع الحاكم كشخص أو الحكومة كأشخاص أما الحرق والتكسير والتعدي على الأخ المواطن وإنهاء حياته أو سلبه ما يملك هو بعيد جدا عن مفهوم الثورة والثوار , فالثائر هو من يضع روحه في مقدمة الأرواح لتحقيق حلم عامة الشعب , وليس الثائر ولن يكون أبدا من الثوار من يعتدي على ممتلكات الوطن أو أرواح أخوته , أو يعتدي على المسلمات الإجتماعية من إحترام الكبير والحنان على الأصغر , أو التعدي على ما إتفق عليه الوطن من مسلمات أو أديان أو تشريعات , ولكن فساد نظام مبارك وإنتاجه لملايين من قاطني المقابر والعشوائيات وأولاد الشوارع مكن المؤامرة من أن تجد جيشا من المجردين من الانتماء وهم ملك يمين من يدفع لهم أكثر , فكانت البلطجية يد الفاعل الذي يدفع ويحرض عن بعد...وهنا آن الأوان لنسأل ....ومن هو الفاعل ؟

طبعا لا زلنا نبحث عن الفاعل , فما حدث في بورسعيد هو فاصل من حدث أكبر , وأعتقد إني بدأت أقترب من فكرة وجود مصالح مشتركة من عدد من المستفيدين والتي أشرنا لها في مشاركة سابقة شاركت في الجريمة وتتفق هذه الفكرة مع فكرة عضو مجلس الشعب من حزب الوسط سلطان والذي قال إنه يبدو إننا في مواجهة أربع مجموعات داخلية
مجموعة الثورة وتنقسم إلى مجموعتين
مجموعة تقودها ثورة سلمية ومجموعة تقودها مؤامرة ماسونية
ومجموعة الدولة وتنقسم إلى مجموعتين
مجموعة تقودها الوزارة والمجلس العسكري ومجموعة لا زالت في النظام وتقودها مؤامرة ماسونية
وهذا قد يفسر معنى التقصير ويفسر إصرار الوزارة على عدم إستخدام أدوات مثل الخرطوش وإصرار بعض الثوار على حدوثها
لذلك أعتقد أن المال الماسوني يتخذ عملاء له في الثورة وعملاء له في أجهزة الدولة وهذا ما يتيح للطرف الثالث إمكانية الإختباء لغاية هذه اللحظة
فمثلا كما وجدنا التقصير في إداء الحماية من أجهزة الشرطة
نجد التقصير في إداء لجنة تقصي الحقائق والتي أنتجتها الثورة ومجلس الشعب لدرجة شكوى الدكتور أكرم الشاعر العلنية حيث قال
أن من أصل 18 عضو من اللجنة التي ذهبت لبور سعيد عاد أغلبهم للقاهرة وعلى رأسهم عمر حمزاوي ولم يبق هناك إلا أربعة
وأتركم مع هذا التسجيل
http://www.youtube.com/watch?v=kfBguYnX7qU

اسماعيل الناطور
02-08-2012, 10:58 AM
المتهم الثالث الوعي ومدى وعي الشباب بالتمييز بين الوطن والحكومة فلقد أنتج نظام مبارك جيلا من الشباب لا يفهم معنى الانتماء ومعنى الحقوق ومعنى الحرية فالمنشآت العامة من متاحف ومباني الحكومة والمعدات والشوارع كل الممتلكات العامة هي ملك الشعب وليس ملك الحاكم ولا الحكومة , الخصومة فقط يجب أن تكون مع الحاكم كشخص أو الحكومة كأشخاص أما الحرق والتكسير والتعدي على الأخ المواطن وإنهاء حياته أو سلبه ما يملك هو بعيد جدا عن مفهوم الثورة والثوار , فالثائر هو من يضع روحه في مقدمة الأرواح لتحقيق حلم عامة الشعب , وليس الثائر ولن يكون أبدا من الثوار من يعتدي على ممتلكات الوطن أو أرواح أخوته , أو يعتدي على المسلمات الإجتماعية من إحترام الكبير والحنان على الأصغر , أو التعدي على ما إتفق عليه الوطن من مسلمات أو أديان أو تشريعات , ولكن فساد نظام مبارك وإنتاجه لملايين من قاطني المقابر والعشوائيات وأولاد الشوارع مكن المؤامرة من أن تجد جيشا من المجردين من الانتماء وهم ملك يمين من يدفع لهم أكثر , فكانت البلطجية يد الفاعل الذي يدفع ويحرض عن بعد...وهنا آن الأوان لنسأل ....ومن هو الفاعل ؟

طبعا لا زلنا نبحث عن الفاعل , فما حدث في بورسعيد هو فاصل من حدث أكبر , وأعتقد إني بدأت أقترب من فكرة وجود مصالح مشتركة من عدد من المستفيدين والتي أشرنا لها في مشاركة سابقة شاركت في الجريمة وتتفق هذه الفكرة مع فكرة عضو مجلس الشعب من حزب الوسط سلطان والذي قال إنه يبدو إننا في مواجهة أربع مجموعات داخلية
مجموعة الثورة وتنقسم إلى مجموعتين
مجموعة تقودها ثورة سلمية ومجموعة تقودها مؤامرة ماسونية
ومجموعة الدولة وتنقسم إلى مجموعتين
مجموعة تقودها الوزارة والمجلس العسكري ومجموعة لا زالت في النظام وتقودها مؤامرة ماسونية
وهذا قد يفسر معنى التقصير ويفسر إصرار الوزارة على عدم إستخدام أدوات مثل الخرطوش وإصرار بعض الثوار على حدوثها
لذلك أعتقد أن المال الماسوني يتخذ عملاء له في الثورة وعملاء له في أجهزة الدولة وهذا ما يتيح للطرف الثالث إمكانية الإختباء لغاية هذه اللحظة
فمثلا كما وجدنا التقصير في إداء الحماية من أجهزة الشرطة
نجد التقصير في إداء لجنة تقصي الحقائق والتي أنتجتها الثورة ومجلس الشعب لدرجة شكوى الدكتور أكرم الشاعر العلنية حيث قال
أن من أصل 18 عضو من اللجنة التي ذهبت لبور سعيد عاد أغلبهم للقاهرة وعلى رأسهم عمر حمزاوي ولم يبق هناك إلا أربعة
وأتركم مع هذا التسجيل
http://www.youtube.com/watch?v=kfBguYnX7qU

http://www.youtube.com/watch?v=m9rV5l-9EqE

http://www.youtube.com/watch?v=IUpcXU-XTwk&feature=endscreen&NR=1

http://www.youtube.com/watch?v=XcpfPjC29x0&feature=related

اسماعيل الناطور
02-08-2012, 11:29 AM
http://www.youtube.com/watch?v=JyME-5jgP8o

http://www.youtube.com/watch?v=fRCtimyZNVc&feature=related

http://www.youtube.com/watch?v=l9o_4xQLAWE&feature=related

تأكيد لكلام البلطجي في الشريط الأول

http://www.youtube.com/watch?v=29ItGU9ZWNo#!

http://www.youtube.com/watch?v=29ItGU9ZWNo#!

اسماعيل الناطور
02-08-2012, 04:03 PM
هل ممكن إنشاء علاقة بين
1-ثورة اللوتس
2-وقوقل
3-ومنظمة فريدم هاوس
4- ومنظمة (aym)
5-ومؤسسة فريدريش ناومان
6- معهد كارنيغي للسلام الدولي
7-مجموعة الأزمات الدولية"




المعذرة أخي محمد شعبان الموجي ....كان لابد من فتح الموضوع اليوم , بمناسبة المؤتمر الصحفي الذي يعلن اليوم أن كل ما كتبناه أو نقلناه هنا أصبح حقيقة , وقد تم تقديم هذه الجمعيات والأفراد للمحاكمة , وأتمنى عليك فتح الموضوع لمتابعة القضية ومبروك يامصر ,,,,الله يحميك يا مصر ,,,,وأرجو من القارئ المتابعة الآن من الفضائية المصرية

اسماعيل الناطور
02-09-2012, 09:54 AM
المعذرة أخي محمد شعبان الموجي ....كان لابد من فتح الموضوع اليوم , بمناسبة المؤتمر الصحفي الذي يعلن اليوم أن كل ما كتبناه أو نقلناه هنا أصبح حقيقة , وقد تم تقديم هذه الجمعيات والأفراد للمحاكمة , وأتمنى عليك فتح الموضوع لمتابعة القضية ومبروك يامصر ,,,,الله يحميك يا مصر ,,,,وأرجو من القارئ المتابعة الآن من الفضائية المصرية




سبقتني بالطلب ... لفتح الموضوع
و لا تعليق ! على الغلق ؟
لنتركه للقارئ!
و لاتستغرب إن رأيت أيضا فقرات من هذا الموضوع
يتم تداولها في فضائيات أو مواقع تحليلية اخرى
تماما كما وجدت بالصدفة موضوعي ( ثلاثية تقسيم مصر)
في مواقع كثيرة و في بعض تصريحات الساساة حول الوضع في مصر
و بنفس النص تقريبا و الكلمات أيضا !
و لذلك أعتب كثيرا على الأستاذ الموجي
عندما يغلق الملتقى امام الزوار




الحاج الفاضل محمد برجيس

منذ أيام علقت في الغرفة الصوتية على مقالك الأخير عن تقسيم مصر
والبداية كانت في محافظة بورسعيد حيث استطاعوا فرض كردون الكراهية
حولها لتصبح معزولة عن باقي المحافظات ، وقد وصل الأمر إلى درجة مخيفة
حيث لم يستطيعوا المرضى السفر من بورسعيد إلى القاهرة لاستكمال علاجهم
وكذلك التجار الذين لديهم مصالح تجارية مع باقي المحافظات لم يستطيعوا
الخروج منها إلى أية محافظة أخرى خوفا من بطش الأهالي بهم ..
لم تنفع معهم الفتنة الطائفية فعكفوا على خطط جديدة ودخلوا من نافذة التعصب الرياضي ،
وهذا إتضح في التقارير اليوم حيث ذكروا عن وجود خرائط تقسيم لمحافظات مصر
إلى أربع مناطق وعليها كلمات بالانجليزية بين أوراق هذه المنظمات
الممولة من أمريكا لتفتيت مصر ، وقد ساهم البعض ربما بحسن نية أو بجهل
في تنفيذها بكل سهولة ، عن طريق انقيادهم بسهولة خلف المدربين
في الخارج على إشاعة الفوضى في مصر بغرض إسقاط الدولة ..،
وكل القوى السياسية تبحث عن مكاسبها الخاصة واللي يلحق،
"ويمكرون ويمكر الله والله خير الماكرين"
صدق الله العظيم
ربنا يحمي مصر الغالية من شرور النفوس الضعيفة
وإن شاء الله سيحميها ،
شكرا لك
تقديري واحترامي

ماجي




الأخت الكريمة الحاجة / ماجي
أسعد الله أيامك بكل خير
من يحب شيئا يشعر به و يتوقع ما قد يحدث له
و لأننا نحن مصر فنشعر دائما بالخطر المحيط بها
بل و ربما نتوقع ما قد يكون مخطط لها .. و متى صدق حبنا لها
نتوقع بدرجة كبيرة ما قد يحدث مسبقا ... و لقد توقعت ما يحدث حاليا
من محاولة عزل محافظة فإن نجح يتم عزل باقي المحافظات

و لكن بالطبع طالما هناك عقول واعية مثلكم .. و اقلام تحب مصر كقلمكم
بالطبع ستشاركين في توعية الناس و تحمل مسؤولية ما يجب عليك تحمله
في توعية القارئ و محاولة نشر الحقائق.. و اعتقد ان ملتقاكي الإجتماعي
أنسب ملتقى لتناول تلك القضية ( محاولة عزل الشعب عن بعضه)
أتمنى أن يكون لقلمكم دورا حيويا في ذلك ... غير أني أشكر لكم
تلك الموضوعية في طرح وجهة نظرك سواء بالغرفة او خارجها

و لعل الأستاذ / اسماعيل الناطور .. دق اجراس الخطر منذ مدة
و كنا نعتب عليه و نفهمه على عكس مايريد و لكن شيئا فشيئا ثبت
أن له بعد نظر للأحداث في مصر و لذلك إنزعجت بشدة عند اخذ موضوعه
و إختزاله في مسار محدد . و المطالبة بغلقة
شكرا جزيلا لك




الأخت الكريمة الحاجة / ماجي
أسعد الله أيامك بكل خير

و لعل الأستاذ / اسماعيل الناطور .. دق اجراس الخطر منذ مدة
و كنا نعتب عليه و نفهمه على عكس مايريد و لكن شيئا فشيئا ثبت
أن له بعد نظر للأحداث في مصر و لذلك إنزعجت بشدة عند اخذ موضوعه
و إختزاله في مسار محدد . و المطالبة بغلقة
شكرا جزيلا لك


الحمد لله
صبرنا وكان لصبرنا ثمن
الحمد لله
الآن لقد صححت ثورة مصر مسيرتها ونظفت ثوبها وعاد الوجه الوطني للظهور بقوة
صحيح أن إختيار طريق التصادم مع الشر والمؤامرة والشيطان صعب
ولكن هل الجنة ودخولها سهل
لقد أراد البعض أن يشوه قيمة الشهيد , فخلط الحابل بالنابل , وإدعى الشهادة أحيانا لبطلجي وأنكرها على جندي أمن مركزي يقوم بوظيفته وفي مكان عمله
لدرجة أن البعض رفض أن يطلق لقب شهيد على شاب في عمر الزهور ذهب ليتفرج على مباراة ...فقتله أحدهم غدرا وظلما وخسة ونذالة
إننا في عصر الدجل والكذب على عامة الناس البسطاء وتقديمهم ضحايا لقذارة الماسونية العالمية وتخطيطها للسيطرة على الشعوب
مبروك لمصر
وشكرا أخي محمد
وكما قلت في عنوان أحد مواضيعي
الكرامة تحتاج لشهيد

اسماعيل الناطور
02-09-2012, 09:55 AM
http://www.youm7.com/news.asp?newsid=597947

"العفو الدولية":


16 دولة ستشارك فى إضراب 11 فبراير تضامناً مع مصر


******
بات كل شيئ واضح تماما الغرض هو اسقاط مصر تماما

قالت منظمة العفو الدولية فى بيان لها اليوم أربعاء إن الآلاف من أنصار منظمة العفو الدولية والنقابيين والطلاب وغيرهم فى 16 دولة سيشاركون فى إضراب مفتوح يوم 11 فبراير، بالتزامن مع الإضراب الذى تمت الدعوة إليه فى مصر، فى الذكرى الأولى لتنحى مبارك عن الحكم.

وأوضح بيان المنظمة: "ستعقد اجتماعات فى المدن فى مختلف أنحاء النمسا، بلجيكا، ألمانيا، فنلندا، فرنسا، إيطاليا، أيسلندا، لوكسمبورج، المغرب، هولندا، نيبال، والنرويج، وباراجواى وأسبانيا وسويسرا والمملكة المتحدة". وتابع البيان: "حقوق الإنسان كانت ولا تزال فى صلب مطالب للتغيير فى الشرق الأوسط وشمال أفريقيا والتى أدت إلى أحداث غير عادية من العام الماضى".

وقال سليل شيتى، أمين العام منظمة العفو الدولية: "فى الذكرى السنوية لمرور عام على سقوط حسنى مبارك، سنتجمع فى الأماكن العامة فى جميع أنحاء العالم لإظهار تضامننا مع الناس فى جميع أنحاء المنطقة التى لا تزال مستمرة للوقوف فى وجه القمع الوحشى بشجاعة وكرامة".

وأضاف شيتى: "نحن نقف أيضا فى تحد ضد أولئك الذين يعارضون التغيير لحقوق الإنسان - قمنا بتوثيق النكسة الشرسة ضد حقوق الإنسان فى بلدان مثل مصر، بينما فى مكان آخر، كما هو الحال فى سوريا، والحكومات وقمع بوحشية المظاهرات يجب أن المسئولين يعرفون أنه سيتم محاسبتهم عن الانتهاكات التى ارتكبوها".

وتابع: " يوم السبت المقبل، فى الوقت الذى نحتفل فيه بالتغييرات التى تحققت فى مختلف أنحاء الشرق الأوسط وشمال أفريقيا فى العام الماضى، سوف نركز على الأمور الأساسية التى يجب تحقيقها فى السنة المقبلة وهى: كبح جماح استخدام قوات الأمن ضد المحتجون، ومكافحة التعذيب ومحاسبة المسئولين عن الانتهاكات للمساءلة".

واستطرد: "من المتوقع أن نرى أكبر مظاهرة، فى المملكة المتحدة والتى ستقام فى ميدان الطرف الأغر فى لندن. كما سيكون هناك تواصل مباشر مع المحتجين فى مدينة حمص وغيرها من مناطق سوريا، و5 مدن فى فنلندا، بالإضافة إلى 5 مدن فى النرويج ستقوم بتنظيم احتجاجات ، بالإضافة إلى نشطاء فى المغرب لتنظيم اعتصام فى الرباط وإسبانيا، بما فى ذلك مدن مدريد ومدن أخرى ، فضلا عن نشطاء فى سويسرا تضامنا مع المتظاهرين فى مصر فى صورة العروض الجوية التى سترسم كلمة "التحرير" بالطائرات.

لقد بدأت المواجهة العلنية , وإنتقلت من كواليس أجهزة المخابرات إلى منظمات ومجالس الأمم المتحدة والتي صممها الماسون للسيطرة والتحكم وخنق الشعوب

قال الله تعالى : ( كُتِبَ عَلَيْكُمْ الْقِتَالُ وَهُوَ كُرْهٌ لَكُمْ وَعَسى أَنْ تَكْرَهُوا شَيْئًا وَهُوَ خَيْرٌ لَكُمْ وَعَسَى أَنْ تُحِبُّوا شَيْئًا وَهُوَ شَرٌّ لَكُمْ وَاللَّهُ يَعْلَمُ وَأَنْتُمْ لا تَعْلَمُونَ )

اسماعيل الناطور
02-09-2012, 01:45 PM
لقد بدأت المواجهة العلنية , وإنتقلت من كواليس أجهزة المخابرات إلى منظمات ومجالس الأمم المتحدة والتي صممها الماسون للسيطرة والتحكم وخنق الشعوب

قال الله تعالى : ( كُتِبَ عَلَيْكُمْ الْقِتَالُ وَهُوَ كُرْهٌ لَكُمْ وَعَسى أَنْ تَكْرَهُوا شَيْئًا وَهُوَ خَيْرٌ لَكُمْ وَعَسَى أَنْ تُحِبُّوا شَيْئًا وَهُوَ شَرٌّ لَكُمْ وَاللَّهُ يَعْلَمُ وَأَنْتُمْ لا تَعْلَمُونَ )[/b][/color][/font]
وعاد الجيش إلى الشوارع والميادين , وعاد الجيش إلى نقطة الصفر التي تبدأ منها الخطة الصحيحة لردع الفتنة , قلنا بدأت الثورة المصرية الحديثة تعود إلى وطنيتها , إنها ليلة زفاف مصر إلى عريسها الذي حاول البعض إختطافه , وإستبداله بعريس مزيف شيطان الضمير يلبس قناع شعارات تدغدغ المشاعر ولا تقدم شيئا , لقد كان سقوط مبارك وأركان فساده ثورة حقيقية ومطلوبة منذ أن وضع مبارك يده في يد من هدم مصر والعراق ولبنان وسوريا واليمن والجزائر وفلسطين وحصار رفح وسرقة البترول والثروة العربية ومناصرة إسرائيل حتى في أوقح القرارات مثل إتخاذ قرار الحرب على غزة من القاهرة وفي مؤتمر صحفي علني مع ذلك الوزير الذي يجب تقديمه أيضا للمحاكمة ( ابو الغيظ ) , مصر العظيمة تعود اليوم إلى حضن الوطنيين من أولادها , وستكتمل ثورتها بنصرة كل مظلوم مصري وبعودة الزراعة المصرية وبعودة الصناعة المصرية وبعودة الريادة والقيادة المصرية , فلا عرب بدون قوة مصر , ولا كرامة بدون جيش مصر وجيش سوريا وجيش العراق وكل حركات المقاومة الشريفة

رجائي كامل
02-09-2012, 02:18 PM
الاستاذ اسماعيل الناطور المحترم
هناك فينا بعض الحميرة حين نتلقى شخصا ليس معروفا لنا اصله وفصله
وتذكر الحمير الذين استقبلوا امين ثابت كمهاجر سوري جاء من الارجنتين الى سوريا كمليونير عام1963م
واصبح من المقربين لكبار المسئولين
كيف عرفنا انه كوهين ؟؟؟
هل نقترب خطوة من اي شخص مجهول ؟
0000000000
اذكر انه في احد معسكرات العائدين الفلسطينيين بقطاع غزة
كان رجلا ادعى الخبل والهبل وكان اهل المنطقة ينادونه : باسم هتلر
لانه كان يسير عظيما متعالي على كل الناس ولا ينطق حرفا واحدا يدعي البلاهة
كان هذا قبل العام1967م
وبعد الاحتلال الاسرائيلي للمنطقة التي عاش فيها هتلر المخبول
اختفى الرجل فجأة / لم يعد احدا يراه في المنطقة
قال البعض انه قتل وان الحجرة التي كان يسكنها قذفت بهاون ومات بداخلها
الكل يتساءل حتى الان اين هتلر المخبول ؟؟
اخرون قالوا متيقنين : انه كان صهيوني متخفي بشخصية رجل مخبول
هل هذا ما يمكن الاقتراب منه لنفهم كم كنا حمير ونحن نصدق :
وجود مليونير في سوريا دون جذور !!!
او نصدق مجهول ليس له جذور انه : مخبول !!!
لنقترب خطوة اكثر
حتى لا نكون للمرة الثالثة حمير ؟؟؟

اسماعيل الناطور
02-10-2012, 11:31 AM
السلام عليكم ورحمة الله وبركاته



الأستاذ إسماعيل ،،



أرجو أن ينتبه الجميع إلى قناة السويس وسيناء



ومشروع الفوضى الخلاقة ..!!



البعض مغيبة الحقائق لديه أو لنقل المؤشرات غير واضحة أمامه



ليرى أنهم مهدوا الطريق على جانبي الطريق المؤدي إلى قناة السويس



فلماذا اليمن وهو بلد لا يتمتع بثروة ؟؟



والصومال وما آلت إليه الأمور فيه



والسودان وتقسيمه وتقطيعه



ثم مصر والتمويل الخارجي بغرض القضاء على الجيش ومن ثمة تفتيتها ...؟!



إذا ربطنا بين الخيوط سنصل حتما إلى النتائج التي لا يستشعرها البعض ...!!



وهذه وجهة نظري التي لن يقبلها البعض ..



شكرا لك




























ماجي


أسئلة فعلا في سياق الموضوع , وأذكرك بموضوع لي سابقا عنوانه قناة البحرين والهدف الإسرائيلي منذ أكثر من مائتي سنة لصنع بديل لقناة السويس , واليوم كتبنا هذه المشاركة أرى وجوب وضعها هنا , وردا على مشاركتك القيمة

تاريخ 16-إبريل -2012م ....يوما هام , لذلك قدمت موضوعا يحمل عنوانه نفس التاريخ

16-إبريل-2012م
عندما قلنا أن الربيع العربي كما كان مطلبا عربيا شعبيا كان هدفا ماسونيا كارثيا , إن الحرب العالمية الثالثة واقعة لا محالة , فأهداف الحرب العالمية الأولى والثانية لن تكتمل إلا بالحرب العالمية الثالثة والرابعة , المسألة مسألة وقت وخلق المسببات المقنعة للشعوب المغيبة عن الهدف الماسوني الأوحد , ألا وهو تدمير الأديان عن طريق نظرية تسمين العجول والتي تتلخص بضرب الخصم بنفسه , ومن يريد أن يتقدم بالوعي عليه أن يبحث عن الحكومة الفعلية التي تقود العالم فهي ليست مجموعة من الأشباح , إنهم أفراد ومال وبنوك وشركات تتحرك بيننا وتستخدم القانون الذي لا يفقهه الكثير من البشر إلا عندما تقع المصيبة , مثل إنتشار جمعيات حقوق الانسان في مصر والتي وصل القضاء المصري الآن إلى الأهداف ولكن معظمها للأسف تستخدم القانون والقانون لا يرحم من تم إستغفاله , ونعود إلى حربنا الثالثة , إن فشل الربيع العربي في تحقيق الهدف الماسوني في سوريا ومصر , هو ساعة الصفر .....ونعود لنقول لإننا قوم نثق بالله .....يمكرون ويمكر الله والله القادر الناصر المهيمن , ولكن يترك لنا الفرصة لنستخدم عقولنا التي أودعها فينا أمانة ....فلا تخونوا آماناتكم بعدم تشغيل عقولكم

اسماعيل الناطور
02-10-2012, 12:22 PM
هل تنجح أمريكا فعلا في جر الصين وروسيا لمواجهة لتحجيمهما ولتقليص نفوذ الصين التجاري وسرقة أسواقها بالقوة ..؟

هل الأمور بهذه البسيطة كما يتخيلها كسينجر ..؟

هل تقوم أمريكا بأعمال أخرى غير البلطجة العسكرية لتحجيم الصين واحتواء روسيا سياسيا في العالم ..؟ أم أن الخيار جاد كما يقول كسينجر .. ؟

هل منطقتنا مهيأة لهذا الحدث وهل المخلصون يستشرفونه؟ وما تأثير مجريات الأحداث القادمة على الربيع العربي ..؟

أرى أن السؤال قد يراه أحدهم بطريقة أخري
هل تنجح(قوى المال الماسونية ) فعلا في جر الصين وروسيا لمواجهة مع(الغرب المسيحي ) لتحجيمه ولتقليص نفوذه التجاري وسرقة أسواقه بالقوة ( بعد ضرب الإسلام بأهله وبمساعدة الغرب المسيحي ) ..؟

اسماعيل الناطور
02-10-2012, 03:05 PM
خبر عاجل ..

نظرا لعدم الإقبال على ركوب الدواب ..

فإن مؤسسات وجمعيات التنقل الدولية

ومساهمة منها في نصرة التنقل على الظهور..... وخاصة ظهور الحمير

تعلن عن تحركات ومؤتمرات ومؤامرات لتنظيم

مليونية سبت العصيان

...


قائد الحمير يتلون ويتلون وإسمعوا آخر الآلوان
http://www.youtube.com/watch?v=DtpCGAHIkyM#!

اسماعيل الناطور
02-10-2012, 09:43 PM
المؤامرة بصوت ممدوح حمزة ,,,,,ويمكرون ويمكر الله والله خير الماكرين


http://www.youtube.com/watch?v=CUU-iJPYuV8&feature=related

اسماعيل الناطور
02-10-2012, 10:17 PM
نتشرت على مواقع التواصل الاجتماعى"فيسبوك" و"يو تيوب"، 3 مقاطع صوتية منسوبة للمهندس الاستشارى ممدوح حمزة خلال حديثه مع عدد من النشطاء، يناقش الإضراب الشامل الذى يعتمد على توقف عمال النقل العام، والسكك الحديدية، والمطارات، الموانئ، والسد العالى والبنوك عن العمل تماما.

التسجيل الأول تحدث فيه عن صعوبة عمل العصيان المدنى، والأفضل هو الإضراب الشامل الذى يعتمد على توقف عمال النقل العام، والسكك الحديدية، والمطارات، الموانئ، السد العالى عن العمل، وهو ما أسماه بـ "شلل المفاصل" للدولة.

أما التسجيل الثانى استكمل فيه حمزة، الحديث عن ضرورة وجود التطهير فى عدد من المناصب مثل البنك المركزي، ووضع حد أدنى وأقصى للأجور فى البنوك، الضريبة التصاعدية، واقترح آخر إلقاء 20 مترا رمل فى منتصف الليل أمام بوابات البنوك حتى تتعطل عن العمل.

وأضاف ممدوح حمزة قائلا : "الأهم أن تتعطل الموانئ عن العمل لأنها هتعمل صخب إعلامى كبيرة وتأثيرها سيكون عن العمل العالم كله هيقول موانئ ومطارات مصر مجمدة، أنا بقولكم إحنا لو عملنا إضرابا بالموانئ والسكة الحديد فقط هينجح.

وفى التسجيل الثالث دار حوار بين المهندس ممدوح حمزة والناشطة جوليا ميلاد ورامى نبيل شعث وفقا لما قالته صفحة "الشهيد علاء عبدالهادى"، استكمل حمزة الحديث عن العصيان المدنى، موضحا أن "أصحاب المصلحة فى تحقيق العدالة الاجتماعية مش العيال الى بيجرو فى الميدان، إنما هم العمال والفلاحون والموظفون ومعدومو الدخل والبطالة.

واقترحت جوليا ميلاد تعطيل نظام العمل بالبنوك أو عمل "هكر" عليها لمدة 24 ساعة، أو قطع الإنترنت عن مصر أو ضعف سرعته حتى تتعطل البنوك عن العمل، بينما، فضل رامى نبيل مساعد العاملين بقناة السويس على الإضراب حتى يكون هناك ضغط عالمى.

وقال المهندس الاستشارى: "إحنا عاوزين السكه الحديد إحنا عاوزين العالم كله يحس بفشل المجلس العسكرى فى الإدراة"، وانهى حديثه "فى ستين دهيه لو هما عايزين يمشوها كده، ده باقى شويا ويلمونا يا يتخلصوا منا" ، كما اتهم المجلس العسكرى والإدارة الأمريكية بالتورط فى كافة الاحداث التى تجرى فى مصر بعد الثورة.

وقد حاولت بوابة الأهرام الاتصال بالمهندس ممدوح حمزة، إلا أن لم يرد على الاتصالات، فيما قال أحد المقربين منه أنه سافر إلى ألمانيا للعلاج.

اسماعيل الناطور
02-10-2012, 11:39 PM
ورد اسم رامي نبيل شعت وهو يحمل الجنسية المصرية
وإبن وزير التعاون الدولي ووزير الخارجية السابق نبيل شعت
وبحثنا ...فوجدنا هذه الصفحة التي تشرح كيف بدأت الفوضى الزمان والمكان والأبطال
http://www.maannews.net/arb/ViewDetails.aspx?ID=433114

: الثورة المصرية في بدايتها وقواها متفقة على دعم فلسطين
- قال الدكتور رامي نبيل شعث، منسق عام حركة المصري الحر، أن هناك شوطا طويلا يتوجب على الثورة المصرية قطعه لإحداث عملية تغيير شاملة تتفق مع أهداف وشعارات الثورة في الحرية والعدالة والديمقراطية والاستقلالية عن التبعية للخارج، مؤكدا أن القضية الفلسطينية كانت حاضرة في جميع فعاليات الثورة الشعبية في شتى الميادين بالقاهرة وغيرها منذ يومها الأول، إما برفع أعلام فلسطين، أو ترديد الهتافات والأغاني الوطنية المؤيدة للنضال الفلسطيني والمناهضة للاحتلال الإسرائيلي، أو حتى بترديد قصائد لعدد من الشعراء الفلسطينيين أمثال محمود درويش وسميح القاسم.

وكان شعث يتحدث خلال لقاء نظمه، الأربعاء، المركز الفلسطيني لأبحاث السياسات والدراسات الإستراتيجية في مقره برام الله، تحت عنوان "شاهد على الثورة المصرية"، بحضور عدد من الشخصيات السياسية والأكاديمية والشبابية.

وافتتح اللقاء مدير عام المركز هاني المصري، بكلمة طرح فيها تساؤلات عدة حول مجريات الثورة المصرية وآفاقها والمخاطر التي لا تزال تعترض طريقها، والتطورات في الخارطة السياسية المصرية مع اقتراب محطة الانتخابات، ومدى تأثير هذه الثورة على القضية الفلسطينية.

هكذا بَدَأت
وعرض شعث لمسيرة الثورة المصرية، التي لم تبدأ منذ 25 يناير، إنما ظهرت بوادرها الأولى منذ العام 2004 بظهور حركة "كفاية" التي عبرت عن رفضها لاستمرار الوضع القائم من فساد وقمع وحكم للحزب الواحد، لاسيما خلال عهد الرئيس السابق محمد حسني مبارك، وبعدها بدأت الأمور تتراكم لتؤسس للثورة.

ففي العام 2006 تظاهرت مجموعة من القضاة مطالبين باستقلال القضاء المصري وفصله عن السلطة التنفيذية، من ثم في عام 2008 تظاهر عشرات الآلاف من العمال في مناطق عديدة بمصر، ما أنتج حركة 6 أبريل، وبلغت هذه الإرهاصات ذروتها في العام 2010 حين حصل الحزب الوطني الحاكم عبر عملية تزوير فاضحة وشاملة على 97% من مقاعد مجلس الشعب، ما أوحى بانسداد الأفق السياسي الداخلي وأكد القناعة بضرورة حدوث تغيير.

وأوضح أن أول اجتماع رسمي للتخطيط للثورة كان في 12/12/2010 وجمع بين قوى فاعلة في حركة الإخوان المسلمين، وناشطين من مجموعة محمد البرادعي، بالإضافة إلى قوى منضوية ضمن الجمعية الوطنية للتغيير وحركة "كفاية" وغيرها من الحركات.

وكانت ميزته أن منح الفرصة للشباب للمشاركة والتحرك على الأرض، واتفق على 25 يناير يومًا للثورة باعتباره رمزًا جامعًا لكل المصريين نحو التغيير، إذ يصادف عيد الشرطة المصرية، بما ينطوي عليه من أبعاد تتعلق بالقمع وامتهان كرامة المواطن.

أما الكيفية، فكانت بحشد أعداد كبيرة من الناس في مختلف المناطق والتجمعات السكانية الشعبية والانطلاق باتجاه الميادين، تحت شعار "يا أهالينا ضمّوا علينا"، مع استخدام أساليب التمويه والتضليل لأجهزة الأمن ووسائل الاتصال الحديثة وغير ذلك.

الثورة لا يمكن وقفها
وفي وصفه لسمات وخصائص الثورة المصرية، حددها شعث بسمات أربع، أولاها أنها حقيقية؛ خرج بها ما يقارب 18 مليون مصري من كل الفئات، وثانيها أنها محلية بأهدافها وجذورها وقواها، الشيء الذي لا يعني بعدها عن الهم القومي والعمق العربي، بالإضافة إلى أنه لا يمكن وقفها بسبب وجود القوى الشبابية المنظمة وهم الجزء الأساسي في حركتها، وأخيرًا تتسم بأنها سلمية من جانب المشاركين فيها، وموحدة تحت عنوان "الشعب يريد إسقاط النظام". وبالرغم من استشهاد نحو 2500 مواطن وجرح ما يقارب ال 10000، ولا يزال 12000 سجين مدني في المحاكم العسكرية، إلا أن الثورة حافظت على سلميتها.

ونوه إلى أن الهدف الأساسي الذي تنضوي تحته كافة الشعارات مثل: الحرية، والعدالة الاجتماعية، والتغيير هو "استقلال مصر"، الذي لم يتحقق رغم الثورات السابقة منذ العشرينيات وحتى 23 يوليو 1952، حيث لا يمكن أن يتحقق أي شيء من الشعارات دون التخلص من التبعية والفساد الذي غرق به النظام السابق وأغرق به مصر دون استقلال أن يتحقق استقلالها من التبعية والهيمنة الخارجية.

بالنسبة لفلسطين.. الثورة محسومة
وركز الحضور في تساؤلاتهم على موقع القضية الفلسطينية الآن من الثورة، وعن دور مصر الإقليمي والمخاوف من الفتنة الطائفية داخل مصر، لاسيما بعد "أحداث ماسبيرو"، بالإضافة إلى وزن القوى السياسية الموجودة في الساحة المصرية والتي تتنافس في الانتخابات القادمة، وخصوصًا دور ووزن شباب الثورة في هذا السياق.

وفي إجاباته، أكد شعث أن "الثورة في مصر غير محسومة في سياق قدرتها على إنجاز عملية التغيير التي تعتبر عملية طويلة، أما بالنسبة لفلسطين فهي محسومة، في إشارة إلى أن كل الأحزاب والحركات المعارضة التي سبق وجودها الثورة، وتلك التي أنشئت بعدها، تتفق على دعم الشعب الفلسطيني وقضيته ومعاداة إسرائيل، لكنها في سياق تحقيق أهدافها الداخلية لا تزال في بداية الطريق، حيث لم تحسم الأمور بعد بالنسبة للانتخابات وما تبقى من النظام السابق وحول إعادة إصلاحه أم تغييره بشكل جذري، بالإضافة إلى وجود أزمة في مصر بالنسبة لدور المجلس العسكري، خاصة بسبب التأخير والمماطلة في الإجراءات الانتخابية في مجلس الشعب وصولا إلى انتخاب الرئيس الذي سيكون على الأقل، وفي أحسن الظروف، في منتصف العام 2013، ما يعني استمرار حالة الغليان وعدم الاستقرار في الشارع المصري.

وأوضح أن كل ما يتجلى الآن من انقسام في أوساط الشارع المصري، ومن ظهور بعض الفتن الطائفية، ليس جديدًا، وهو نتاج 30 عامًا من حكم مبارك خطط له وأداره جهاز أمن الدولة في معظم حالته، عبر تجنيد 165 ألف بلطجي وظف دورهم للترهيب والتخريب، كما تبين في التخطيط لهدم وحرق الكنائس وخلق المناوشات بين المسلمين والأقباط، منوها إلى الدور الإيجابي الذي لعبه المسلمون في عدم انصياعهم لتحريض وسائل الإعلام الرسمية علنا ضد المسيحيين الذين تظاهروا في "ماسبيرو" واشتبكوا مع قوات الأمن، مؤكدًا على أن الحدث كان مخططًا له، ولم يحدث فيه أي حادث طائفي.

وحول دور مصر الإقليمي، قال شعث إن مصر في هذه المرحلة الانتقالية لا تستطيع القيام بدورها على الوجه الأكمل، إذ تعمل على تحقيق استقرارها واستقلالها الداخلي بداية، ولكن مع الخطر المحدق بالمنطقة بسبب التدخل الخارجي في الثورات العربية، هناك فرص أيضًا لبروز عدوى الثورة وانتقالها إلى بلدان عربية أخرى.

أما الإيجابية الظاهرة في حالة التحضير للانتخابات وتختلف عن سابقتها بالرغم من قانون الانتخابات غير المتوازي مع حركة التغيير ومحاربة الفساد، فرأى شعث أنها تكمن في وجود خيارات متعددة لدى المواطن المصري للانتخاب، وليس كما في السابق حين كان الخيار محدودًا بين الإخوان المسلمين والحزب الوطني الحاكم، حيث تتنافس في الانتخابات القادمة الأحزاب المنبثقة عن الثورة والكتلة الديمقراطية والقوى الإسلامية، بالإضافة إلى ثمانية أحزاب ناتجة عن تفكك الحزب الوطني. بالإضافة إلى ذلك، سيتمكن المصريون المقيمون خارج مصر أيضا من الانتخاب، وهؤلاء سيكونون خارج السياق التقليدي من الأحزاب ومع قوى التغيير الجديدة، وإن اعتبر أن التحضيرات لمشاركة المصريين في الخارج قد يؤدي إلى تأجيل موعد المرحلة الأولى من الانتخابات المقررة نهاية الشهر المقبل.

اسماعيل الناطور
02-11-2012, 12:38 AM
المشكلة مين اللي سرب التسجيل
و من الذي سجله ؟


رأفت الهجان ما زال حيا ...لا تصدق قصة موته ...حسني مبارك الله لا يسامحه كان مجمده في ثلاجة حتى يلعب على كيفه
نفس التسجيل يا أ/ إسماعيل
و لكن يقول مقدم البرنامج أنه لا يعرف الأشخاص
فمن الذي وضع و حدد أسماء بعينها على الفيديو السابق لكم
هل هناك محاولة لتخوين الكل و تشكيك الكل في الكل
و لذلك كان سؤالي السابق من الذي سجل و من الذي سرب !

http://www.youtube.com/watch?v=ssg8aaun2ag


هناك محاولة لتشكيك الكل في الكل
و تخوين البعض ناهيك عن تاريخ التسجيل!
فمن السهل وضع اي اسم على الفيديو لأي شخص
فما المقصود من ذلك


أنا تعودت لا أكذب ولا أصدق أي خبر ومهما كان مصدره , وبعد ذلك أخضعه للبحث , ومن خلال البحث إما تزداد نسبة المصداقية أم نسبة الكذب , لذلك قمت فورا بالبحث عن رامي نبيل شعت , وبعد أو وجدت أن رامي أيضا مشارك وفاعل وشاهد وهو رجل أعمال ويعمل والده في مجال الانترنت ووسائل الاتصال والتعاون الدولي , حتى تذكرت عبارة عن الأخوية في العلاقات الماسونية , وأن الأخ في الماسونية يعلو في التعاون معه عن الأخ إبن الوطن , فنظام العولمة الماسوني نظام شيطاني مالي يقدم المنفعة الشخصية والأخوية عن الوطن والأخ الذي يكون من إمه وأبيه وهنا صفوت حجازي مقدم الشريط وهو يكذب عندما يقول إنه لا يعرف الأشخاص وخاصة ممدوح حمزة فصوته معروف وواضح ولكن صفوت حجازي والذي إخترعوا له وظيفة مقدم برامج حتى يكون التمويل قانونيا , يريد أن يقدم الشريط لأن الأخوان أخذوا طريقا آخر غير طريق التحررين , فأراد أن لا يورط نفسه وينقذ جماعته مع قضية الاتفاق على الاعتصام فقدم الشريط بهذه الطريقة ....هكذا أفهم مما تقدم به للمشاهدين , وأنت تذكر إني قلت إنه وعلى ما يبدو أن الأخوان قد وضعوا يدا مع البرادعي ويدا أخرى مع العسكري وهم مع المنتصر منهم , حتى يقطفوا الثمار كما قطفوها في الانتخابات , على المواطن أن يكون أكثر وعيا , فالسياسة طريق مليئة بالأشواك والكل يبحث عن الكعكة والكرسي ولو على حساب الوطن , لذلك أثق في الجيش لأنه إختار من يوم دخوله الجيش أن يكون أقرب للموت من الحياة

اسماعيل الناطور
02-11-2012, 08:36 AM
http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc7/430303_307597695954434_100001126179700_819434_1296 381303_n.jpg

وهكذا وقع سامح نجيب الأناركي الذي يريد تفكيك الجيش المصري بين يدي الشعب الغاضب

هل أخطأنا عندما وصفنا البعض بالحمير , فها هو سامح نجيب يثبت غباءه بعد أن أنقذه الجيش الذي يريد تفكيكه

عبر سامح نجيب أحد قادة الاشتراكيين الثوريين عن شكره وامتنانه للقوات البحرية بعد أن تدخلوا لإنقاذه من بين أيدي المتظاهرين بالقرب من قصر رأس التين بالإسكندرية، والذين كادوا أن يفتكوا به باعتباره أحد المناهضين للمجلس العسكري.

قال نجيب: إنه في أثناء سيره بالقرب من منطقة قصر رأس التين حاول بعض المتظاهرين الاعتداء عليه في أثناء استقلاله لسيارة تاكسي، إلا أنه تصادف مرور سيارة تابعة للقوات البحرية وقامت بعمل كردون حول التاكسى وإنقاذه من بين أيدي المتظاهرين.

http://www.youtube.com/watch?v=i0eGSz0rwA4
شوفوا الكذاب بيتمشى على البحر وبالصدفة بالقرب من مظاهرة معلن عنها لتأييد الجيش

اسماعيل الناطور
02-11-2012, 11:41 AM
لقد قامت قنوات التحريض الطائفي الصهيوأمريكية على مدى الأشهر الماضية باستخدام أحدث وسائل
التكنولوجيا الرقمية في التصوير والتزيف والفبركة من أجل ما يفخرون بأنه صناعة الخبر وصناعة
الحدث وتفريخ الثورات من خلال التأثير الكبير للخبر المصنع فيلميا .. وخصوصا على الرعاع
الذين يعانون من ضحالة معرفية وتقافية وبالأخص في أمية مجالات التقنية الرقمية والتصوير
ويعرض علينا هنا شاب تقني تجربة بسيطة لمحاولة تزييف وفبركة ولكن يبقى الأهم من هذا الكشف
أن الموقف السياسي والأمزجة الفكرية للبعض تميل للتمسك بموقفها وتصر على تأييد المزيف
وتكذيب الحقيقي حتى لو ثبت التزييف في الخبر وتلك هي الطامة الكبرى وهذا ما تسعى إليه
محطات الفتنة .. أنها الفتنة والانقسام بين أبناء البلد الواحد فما بالك بأبناء البلدان المنقسمة
كان الله في عون بلادنا أمام ما يعده الخونة والعملاء ..

إليكم لقطة " جمعة الكلب الأخضر عضني "





http://www.youtube.com/watch?v=QAEoa9a1c2U&feature=player_embedded
صباح الخير أخ صادق
أنا لا أعلم لماذا غضب البعض منا
عندما أطلقنا شعار سبت البرسيم
فالبرسيم ليس رخيصا بل هناك من يشتريه بالدولار

http://www.youtube.com/watch?v=ldjCW2oyqWw&feature=related

اسماعيل الناطور
02-12-2012, 08:54 AM
أطلق الداعية الإسلامى، الشيخ محمد حسان، مبادرة حملت اسم "المعونة المصرية" للاستغناء تماما عن المعونة الأمريكية، "عسكريا واقتصاديا"، بحيث يبدأ التنفيذ الحقيقى للمبادرة من الليلة، تمهيدا لإبلاغ الجهات المسئولة فى مصر، وهم (المجلس العسكرى ومجلس الوزراء ومجلس الشعب) بإلغاء المعونة الأمريكية نهائيا، وتعهد "حسان" بجمع مبلغ المعونة فى ليلة واحدة، قائلا: "أقسم بالله وعلى مسئوليتى أمام الله أن الشعب المصري سيجمع مئات الأضعاف مما كانت تقدمه لنا أمريكا من معونات تافهة".

جاء ذلك، على شاشة التليفزيون المصرى، من خلال برنامج "ستوديو 27"، حيث كان ضيف البرنامج الذى استمر حتى الساعات الأولى من صباح اليوم الأحد، وأضاف: "أقول لأمريكا.. مصر قامة كبرى.. وستبقى قيمة إلى أبد الدهر.. ولن نركع أمام معونتكم التافهة.. ولن نُذل أمام بضع ملاليم.. وأقسم بالله أن الشعب المصرى سيجمع من خلال شبابه وعلمائه ورجال أعماله..حتى السيدات اللاتى يبعن "الجرجير والطماطم فى الشارع".. عشرات المليارات من الجنيهات لهذه المبادرة، حتى لا ينكسر المصريون أمام دولة عدوة مثل أمريكا.

أضاف: "إذا كانت أمريكا تحاول كسر مصر بـ 1,3 مليار دولار، فإننى أقسم لكم بأننى بهذه المبادة -بفضل الله- أستطيع جمع هذا الملبغ فى يوم واحد، لأن مصر أرض العطاء، والجود، ولن يقبل مصرى واحد أن تذله أمريكا مهما كان المقابل "وحتى لو مات من الجوع".
وقبيل انتهاء البرنامج بدقائق معدودة، انهالت المكالمات الهاتفية لتأييد المبادرة، من رجال أعمال مصريين، غالبيتهم يعيشون خارج مصر، وعدد من القضاة والمستشارين، وائتلاف ضباط الشرطة ونقابة الفلاحين وعمال مصانع النسيج والشيخ أحمد المحلاوى، خطيب مسجد القائد إبراهيم بالإسكندرية، معلنا أنه سيبدأ من اليوم جمع التبرعات رسميا تحت اسم "المعونة المصرية".

وطالب المتصلون بالبرنامج -الذى رفض الرد عليهم لكثرة عددهم وتأخر الوقت- معرفة رقم الحساب الذى سيتم التبرع عليه باسم المبادرة، فرد الشيخ محمد حسان بلغة الفخر من سرعة رد فعل الجمهور مع المبادرة وظهرت فى عينه الدموع: "مصر لن تسقط.. وغدا سيتم البدء فى فتح الحساب بعد الاتفاق مع المسئولين بالدولة".

اسماعيل الناطور
02-12-2012, 12:55 PM
http://www.youtube.com/watch?v=FE2pD9iVXks#!

امر النائب المستشار عبدالمجيد محمود بتحويل البلاغ رقم 417 لسنة 2012 المقدم من قبل حركة الإخوان المصريين ضد المهندس ممدوح حمزة الامين العام للمجلس الوطنى بسبب الفيديوهات التى تم نشرها مؤخرا على صفحات الانترنت والتى تدل على مؤامرة ممدوح حمزة لاسقاط الدولة المصرية وتعطيل المصالح والمؤسسات الحكومية والهيئات العامة يوم 11 فبراير تصعيدا للاعتصام والعصيان المدنى الذى تم الحشده له من قبل قوى سياسية وائتلافات شعبية مختلفة فقد قرر تحويله الى نيابة امن الدولة العليا وقد اشار البلاغ ان ممدوح حمزة يقوم بتلقى اموال من الخارج لتمويل جماعات وحركات شبابية من اجل اسقاط الدولة المصرية فيما قد اكد المهندس حمزة بأن تلك التسجيلات تم فبركتها له وانها ليس لها ادنى واقع من الصحة

http://www.youtube.com/watch?v=h1xe3JgdVOM#!

اسماعيل الناطور
02-12-2012, 03:55 PM
http://www.youtube.com/watch?v=vwcSmYhKaTk#!

فيديو مؤثر جدا ....لكن إسمعه لنهايته

http://www.youtube.com/watch?v=YX-pCL-0xnE#!

http://www.youtube.com/watch?v=iDvfP2edctU#!

http://www.youtube.com/watch?v=cPhTGQOa1TQ

اسماعيل الناطور
02-14-2012, 09:04 AM
وهذه أول وأعظم خطوة تم تأسيسها لبناء مصر وقهر أمريكيا
والله لو كل بلاد العرب استغنت عن عطايا امريكيا المذلة ومن والاها واكتفينا بصناعتنا المحلية لعم الخير وتحقق النصر

كل التحية والتقدير
الهدف من هذا الموضوع هو العودة إلى شعار الممانعة والمقاومة
الممانعة بأن نحصن القدرة الذاتية والجبهة الداخلية والنفسية العربية بهدف وقف المزيد من الخسائر
والمقاومة بأن نقدم بدائل إن كانت فكرية أو تحالفية أو عسكرية لتقليص أو تشتييت قدرات العدو بهدف وقف المزيد من الخسائر
وهنا وفي حالة مصر بالذات كانت الثورة مطلبا شعبيا من كل فئات الشعب المصري وتصادف إنها مطلبا ماسونيا صهيونيا ملحا رغم ما قدمه نظام مبارك للعدو
وكانت الثورة وكانت الشرارة والشعب المصري يظن إنه من بدأ والقوى الماسونية تظن إنها من بدأ ولكن الحقيقة أن الله أراد لها أن تكون في هذا الوقت بالذات
لذلك يحاول الشعب المصري الحفاظ على ثورته ويحاول أن يحقق من خلالها شعار عيش كرامة حرية ديمقراطية
وفي نفس الوقت يحاول الوجه الماسوني الحفاظ على ثورته ويحاول أن يحقق من خلالها هدف الفوضى والدم والتشرذم وصولا للتفتييت والتقسيم وتدمير الجيوش
إذن كان لابد من التصادم بين الوجه الوطني للثورة والوجه الماسوني للثورة , لأن الأهداف وإن إجتمعت يوم 25 يناير , إختلفت الآن لإنها من التناقض بمكان يستدعي مواجهة وربما حرب لا هوادة فيها ...وبدأت الحرب ...مليونيات بدون سبب, تظاهرات ومطالب فئوية مستعجلة , كسر الشرطة والقضاء , وأخيرا كسر الجيش وهو الضمانة الوحيدة للوجه الوطني للثورة لتحقيق أهدافه , فكان يجب الرد بعد صبر والكشف عن التمويل ومصادره وأدوات الوجه الماسوني , فلم يترك الوحه الماسوني للمجلس العسكري ولا فرصة واحدة إلا طريق التصادم مع أمريكا والتي تمثل الممثل الظاهر للوجه الماسوني , وهنا بدأ الإبتزاز إبتزاز المعونة والضغط المالي لإحراج الوجه الوطني إمام الشعب وتركيعه , ولكنهم من الغباء المستمر الذي يكررونه كل مرة مع العرب ومن ألوف السنيين , ألا وهو مقياس الكرامة , ومقدرة فعل الكرامة في نفسية العربي وقدرتها على دفعه للممانعة والمقاومة والقتال حتى النصر أو الشهادة

اسماعيل الناطور
02-15-2012, 06:22 PM
http://www.almolltaqa.com/pic2/news1/111111.jpg
http://www.almolltaqa.com/pic2/news1/1.jpg
http://www.almolltaqa.com/pic2/news1/2.jpg
http://www.almolltaqa.com/pic2/news1/3.jpg
http://www.almolltaqa.com/pic2/news1/4.jpg
http://www.almolltaqa.com/pic2/news1/5.jpg
http://www.almolltaqa.com/pic2/news1/6.jpg

صحيفة الوفد المصرية 26يناير 2012


الحمد لله أن جعل العرب يبدأون القراءة الجادة لعلهم يفطنون لما يخطط لهم و منذ مدة طوييييييييييلة و ليس منذ فبراير 2011 !
إن الغرب "الصهيوصليبي" لن يترك المسلمين ... مسلمين !
أشكر لك أخي الفاضل الأستاذ محمد، أستاذ الجيل، هذا النقل الأمين !
تحيتي و مودتي.



في جمعة تحدي والمحافظة على الوطن وليس من الجمعة التي قلبوها (سبت) الفوضى , أريد أن أضيف شيئا مهما
في إثناء زيارتي الأخيرة لمصر , سألت أحد المواطنين الشرفاء وهو محامي مشهور
ما دام قضية التمويل الخارجي قضية واضحة جدا , فلماذا هذا التردد الحكومي في القبض عليهم ؟
وهنا كانت إجابة صاعقة ...
قال الرجل : هؤلاء كانوا يعلمون إنهم يتآمرون , لذلك أعدوا كل شيئ حسب القانون
فمثلا ...
إذا أردت أن تمول شخصا وبالقانون , فما عليك إلا أن تفتح له باب رزق وتعينه موظف وتتعاقد معه على الراتب الذي تريده , فأنت حر بأموالك , لذلك تجد شخصا كمظهر شاهين إمام مسجد أصبح مقدم برامج في فضائية والتمويل عبارة عن راتب قانوني , ولو بحث عن أعضاء 6 إبريل مثلا , ستجدهم موظفين في جمعيات قانونية أو خيرية رسمية
والراتب لا تسأل عنه ...كله بالقانون ....
ولكن ما يربطهم جميعا هو مؤسسات وجمعيات وشركات قانونية لا تربح شيئا
ولكنها تعطي رواتب خيالية
والغطاء العمل الانساني والخيري الغير هادف للربح ..
.لذلك فمسألة التمويل تحتاج لقرار من رجل شجاع وليس لقرار من محكمة

اسماعيل الناطور
02-21-2012, 08:43 AM
تألمت كثيرا وأنا أشاهد مجموعة من المثوريين الجدد من سوريا وهم يتضاحكون بينما يقوم مجلس الشعب المصري بتناول الأزمة السورية وإصدار القرارات في منتهى السطحية وبيع المواقف والتي ستكلف العرب ومصر أولهم الكثير في يوم قادم لابد منه, وأقول السطحية هنا لعدة أسباب أولها أهمية الكلمة على الوضع السوري الآن وثانيها أهمية سوريا للأمن القومي لمصر والتي تظهر لكل من قرأ تاريخ وثالثها
المقارنة بين التعامل كمجلس شعب منتخب مع القضايا المصيرية, فنجد أن سجن حسني مبارك في مستشفى السجن أو مستشفى خاص يستحق لجنة تقصي حقائق بينما دولة عربية أخرى وجيش عربي آخر يتعرض للمهانة لا يستحق لجنة تقصي حقائق , وللأسف لو نظر بعض أعضاء المجلس كيف كان وفد المثوريين يستعرض بالعلم ويتضاحكون ويصفقون عندما سمح لهم بالإقامة دون رسوم في مصر , لعلم البعض أن هؤلاء لا يفكرون بالدم السوري من قريب أو بعيد , أرجوكم ابحثوا عن الفيديو وتعلموا قراءة الوجوه ولغة الجسد لتدركوا وتفرقوا بين المنافق العابث والوطني الغيور الذي يتألم على الدم , إن مجلس الشعب المصري تأخذه قضايا الانتقام من مبارك ورجاله أكثر مما تأخذه المناقشات واللجان لدراسة مستقبل مصر , فهل قدم أحدهم طلب إحاطة عن المعلومات الكثيرة التي تفيد بأن هناك نية لتقسيم مصر , وهل هناك أحد قدم طلب نقاش للمعلومات التي تفيد بمشروع إسرائيلي لضرب قناة السويس , وهل هناك أحد قدم طلب نقاش حول التمويل الأجنبي الذي يتكلم فيه الطفل قبل من فاته الزمن , لا أجد في مجلس الشعب المصري المنتخب إلا الميل للانتقام وتوزيع شهادات الشهادة على كل من هب ودب دون مناقشة تعريف الشهيد ومن هو الذي يستحق اللقب ,لقد كان إصدار قرار بشأن سوريا دون إرسال بعثة لجنة تقصي حقائق من المجلس إلى سوريا والاعتماد على أخبار الجزيرة وتلفيق هؤلاء المتضاحكون بينما يسيل الدم ......كان سطحية وربما غباء سياسي مقارنة بلجنة تقصي حقائق لأحوال سجن !!!!!

اسماعيل الناطور
02-21-2012, 09:37 AM
ورد هذه العبارة في البيان " إنه يجب الحشد لإقناع النظم الداعمة للنظام السوري وخصوصًا الصين وروسيا وتعريفهم بمخاطر هذا الدعم. "
وهنا نجد سطحية التعامل حتى مع الدول العظمى فالمجلس يقول الحشد لإقناع الصين وروسيا بالمخاطر وكأن الصين وروسيا دول من العالم التاسع ليس لديها أجهزتها الخاصة للبحث والتقصي والعمل من أجل مصلحة بلادهما , فإستخدام تعبير تعريفهم مضحك , كما أن موافقة رئيس المجلس الفورية على تبديل كلمة تجميد العلاقات بتعبير قطع العلاقات دون العودة إلى مجلس ألأمن القومي والمناقشة الموسعة حول معاني وجدية الموقف وتأثيره النهائي على مصالح مصر وسوريا يظهر مرة أخرى أن المجلس يحتاج لأكثر من أن يقف العضو ليعبر عما رآه في فضائية أو قرأه في جريده أو طلب موافقة لأحدهم , والسؤال
هل الدول العظمى تناقش مصالحها هكذا على الهواء وكأننا في مجلس عمودية ؟ّّّ!!!
على أعضاء المجلس أن ينظروا للإمام قليلا حتى لو كان تفكيرهم الإستراتيجي شبه معدوم , فالقرارات المصرية لا يمكن تمريرها على الهواء , لأن التراجع صعب إذا ما وجد نفسه السياسي يوما مجبر على التراجع

اسماعيل الناطور
02-22-2012, 08:40 AM
لو سألنا سؤال بريئ جدا
ماذا فعلت إسرائيل إثناء الربيع العربي والربيع الماسوني ؟
هل خافت وإرتعشت وقالت الأشاوس من بني الإسلام قادمون للأقصى ؟
هل سمعنا بعرض سلام أو مفاوضات أو تراجع أو حتى كلمة ود لمن سرقوا آراضيهم وكراماتهم ؟
الحقيقة كل هذا لم يحدث , وما حدث كان العكس تماما , في الخليل تم السماح لليهود بالدخول للمسجد الإبراهيمي , وفي الأقصى تم السماح لليهود بالتجوال كيفما يريدون , وفي غزة يتصايدون من يريدون ويقصفون وقتما أرادوا التسلية والعقاب بالدم الفلسطيني , وفي الضفة يغيرون ويأسرون ويخطفون ويربدون وقتما شاء الجندي الإسرائيلي إذلال من كان فدائي من فتح , وفي سيناء التهريب والتسلل إلى مصر على عينك يا تاجر , وليس هذا فقط بل أن الحكومة الإسرائيلية وافقت على مشروع إيلات إسدود ومنافسة قناة السويس ومصر كمرحلة أولى من مشروع قناة البحرين , ووافقت أيضا على مشروع مد أنابيب نقل البترول إلى عسقلان ومنافسة سوريا على خط أنابيبها المغلق من أيام غزو العراق , إسرائيل تعمل وتعمل وإخوتنا في الربيع يتناقشون ويتصايحون ...وليس هذا فحسب , بل يقتلون أي إحترام لكلمة عربي ....
أتعجب لماذا لم يناقش لغاية هذه اللحظة مجلس الشعب المصري أي قضية إسلامية عامة أو عربية تحت منطق وأعدوا لهم ما إستطعتم من قوة , الأغرب من ذلك أن تجد لا فرق بين نظام مبارك للسياسة الخارجية وبين نظام الأخوان , الاتفاقيات التي رفضوها لمبارك , أصبحت الآن إتفاقيات ومواثيق دولية , والمعونة التي كانت مرفوضة أصبحت الآن جزء من إتفاقية كامب ديفيد وعلى أمريكا أن تقدمها لمصر تحت بنود الإتفاقية .....السؤال للقارئ ...إذا وجدت شيئا يختلف به الإسلام السياسي عما كان يقوم به مبارك ...فلتساعدنا وتكشف عنه , لإننا نثق أن الربيع لم يكن إلا ربيع الماسون....حتى شتيمة رأس الجيش أصبحت عادي في زمن قلة الأدب

اسماعيل الناطور
02-23-2012, 01:50 AM
هل يتذكر أحدكم الحائط الحديدي الإسمنتي الذين زرعه نظام حسني مبارك على الحدود بين غزة ومصر ؟
من نسى الموضوع فعليه أن ينعش ذاكرته بالعودة إلى موضوع قناة البحرين والذي لا زال موجودا في الملتقى الخاص
ولكن ليس هذا الموضوع , الموضوع هو أن الأخوة في جماعة أخوان مصر أقاموا الدنيا على الموضوع وهم على حق بذلك
إلا أن الغريب أن لا أحد منهم يذكر الآن الموضوع بعد أن وصلوا للبرلمان , ولم يشكل أحدا لجنة تقصي حقائق ولا حتى مناقشة الموضوع
وكأن الأمن القومي المصري لن يتحقق إلا بمطادرة الداخلية وشتم الجيش وإهانة المجلس العسكري المصري , على العموم لا زال الوقت مبكرا لنصدر الحكم على برلمان ما بعد الثورة
http://www.almolltaqa.com/ib/showthread.php?39239-%DE%E4%C7%C9-%C7%E1%C8%CD%D1%ED%E4(%D1%DD%CD)

اسماعيل الناطور
02-23-2012, 02:32 PM
من الضروري بمكان تسمية الأشياء بمسميات تعطي معناها بشكل دقيق
و أراك أستذنا / اسماعيل شططت كثيرا عندما أسميت الربيع العربي بالربيع الماسوني
بالفعل هناك ربيع عربي حقا أو قل إن شئت ربيع العواصف العربية لكن ان تقول :
الربيع العربي أو الماسوني فهذا محض خيال
فلا يمكن أبدا ان يكون الربيع العربي و الماسوني
شيئا واحدا .. بل الأصح ( الربيع العربي المشوه ببعض الماسونية )
***
أم انك تقصد أن هناك ربيعان أحدهما عربي و الأخر ماسوني ؟
بمعنى ربيع ماسوني بالبلاد العربية موازي و متشابك مع الربيع العربي
******
أمر أخر
لقد وصفتم فعل البعض من نواب البرلمان المصري بأنه سطحي تجاه الصين و روسيا
و عللت ذلك بأن لديهم ( أي الصين ) أجهزة و مؤسسات تعني بذلك و من ثم تتخذ قراراتها
وفق تقارير تلك الأجهزة !
فلم أيضا لا تقول بأن مصر لديها أيضا أجهزتها و بناء على تقاريرها يتم
تبني هذا الإتجاه حول النظام السوري .
و بالمثل أيضا ان للدول المعارضة للنظام السوري هي أيضا لديها اجهزتها و إستخباراتها
و من ثم تتخذ أيضا نفس إتجاه مصر ... فهل للصين أجهزة
و باقي الدول المعارضة لها ليست لديها أجهزة
اليس ذلك مقياس خاطئ !





فعلا هذا ما أقصد هناك ربيع عربي قام به جموع الشعب المصري والجيش المصري كما فعلت تونس واليمن وليبيا وسوريا ومن سيستجد بالقائمة العربية قريبا وهناك ربيع ماسوني قام به كل من قبض مالا أو أصدر بيانا بدعوة الغرب لإغتصاب الأوطان والتشابك وصل لدرجة الخلط وتزييف الوعي للمواطن العادي فما تقوم به الفضائيات وخاصة الجزيرة هو واحد وهدف واحد ولكنه كان مقبولا من المواطن الليبي على سبيل المثال ومرفوضا من المواطن السوري والآن من المواطن المصري , لقد كان وضع جميع الدول العربية على مقياس واحد هو يد شيطان يجب قطعها , ويجب أن تكون بوصلة الشعوب قوتها الذاتية وكل من يقترب منها هو عدو وليس ثائر , والقوة الذاتية في كل دولة عربية هو المحافظة على جيشها درعها وسيفها وضمان وحدتها , لذلك قد يجدني القارئ مع ما يحدث في دولة وضد ما يحدث في دولة أخرى لأن مقياسي هو نصرة أولادها الذين يريدون وحدة بلادهم وليس أولادها الذين يريدون تفتيت أوطانهم , أما الرؤساء فهم أفراد نجد مثلهم وأفضل منهم في كل تجمع عربي شريف

اسماعيل الناطور
02-23-2012, 02:33 PM
أمر أخر
[color=red]لقد وصفتم فعل البعض من نواب البرلمان المصري بأنه سطحي تجاه الصين و روسيا
و عللت ذلك بأن لديهم ( أي الصين ) أجهزة و مؤسسات تعني بذلك و من ثم تتخذ قراراتها
وفق تقارير تلك الأجهزة !
فلم أيضا لا تقول بأن مصر لديها أيضا أجهزتها و بناء على تقاريرها يتم
تبني هذا الإتجاه حول النظام السوري .
و بالمثل أيضا ان للدول المعارضة للنظام السوري هي أيضا لديها اجهزتها و إستخباراتها
و من ثم تتخذ أيضا نفس إتجاه مصر ... فهل للصين أجهزة
و باقي الدول المعارضة لها ليست لديها أجهزة
اليس ذلك مقياس خاطئ !



نعم مقياس خاطئ لو كنت أقصد ذلك , ولكن لو رجعت للمشاركة , لوجدت إني إنتقدت المجلس لهذه المناقشة العلنية ودون لجنة تقصي حقائق ولدرجة أن رئيس المجلس الذي أحترمه لشخصيته القوية إلا إنه إعتمد تغيير تعبير أزمة إلى ثورة وتعبير تجميد إلى قطع علاقات دون العودة إلى الوزارات المختصة وأجهزة الدولة الجيش والمخابرات دون إعتماد تعابير مصيرية , هنا كانت السطحية والتى كانت تعتمد إرضاء بعد الأصوات العالية في البرلمان أو خارجه دون تحويل الأمر بكامله إلى مؤسسات الأمن القومي المصري , بالتأكيد هناك في مصر عباقرة ولكنهم ومع هذا الصراخ أصبحت آياديهم مرتعشة وهذه ليست مصر التي كانت تطلب فتطاع , رحمة الله على عبد الناصر الذي خرج يوما وفي خطاب علني ,,,الأسبوع القادم مؤتمر قمة عربي ...فكان , ورحم الله السادات الذي قال يوما ....مصر لا يقاطعها أحد بل هي التي تقاطع وفعلا إنسحب من الجامعة العربية , عتبي على مجلس الثورة أن لا يكون مجلس صراخ على توافه الأمور , يجب أن يكون المجلس مجلس ثورة يخيف العدو ويجبر المتردد على الإقدام , لكن للأسف أجده لغاية هذه اللحظة مجلس غرام وإنتقام , غرام في الغرب وإنتقام من كل من كان ضدهم يوما ولو كان على حق , لماذا قتلوا السادات ؟ أليس من أجل كامب ديفيد كما قالوا أم إنهم كانوا إمعات ومغيبين وبدون عقل ونفذوا ما طالبهم بهم البعض , اليوم تنكشف الحقيقة , فكل من مع كامب ديفيد والمعونة والاتصالات مع الغرب هو منافق دجال يبحث عن الكرسي ولا فرق بينه وبين مبارك إلا باللحية فلقد كان مبارك بدون لحية وهم بلحية أم الفعل والإسلام فما زال ينتظر منهم الكثير , لقد بدأنا بالترويج للمعونة المصرية للشيخ حسان ...فهل فعل مجلس الأخوان شيئا ...والمعونة هي من الربا الواضح على الأقل

اسماعيل الناطور
02-23-2012, 03:54 PM
هل هذا يجوز على قناة تدعي إنها مصرية ....

الصبح طالع لِقِى دبابة فوق راسُه
مربَّعة فوق دماغُه وكاتمة أنفاسُه
والشرق مقفول وخِتْمِ النِّسر ترباسُه
...
http://www.youtube.com/watch?v=IP8gURPhPVA

ولكن الرد قادم ولو تأخر
ناشطون ينظمون وقفه أمام قناة "اون تي في"
دعا عدد من الناشطين لتنظيم وقفة احتجاجية أمام قناة "اون تي في " بحي الزمالك الخميس لوقف ما أطلقوا عليه التحريض ضد الجيش واستغلال الأطفال .
وقال ناشطون عبر صفحتهم على "الفيس بوك"، انه سوف يشارك الجميع في وقفة ضد ما أطلقوا عليه إعلام الفتنة والتحريض وذلك بسبب استغلال الأطفال اقل من 12 سنه والتحريض ضد الجيش المصري وذلك أمام مقر القناة .

اسماعيل الناطور
02-24-2012, 02:27 AM
المشير يرفض طلب رئيس الاركان الامريكي بالافراج عن 19 حقوقى مقابل استمرار المعونة
12 فبراير 2012 م 16:58


المصدر إيجى بريس




اضطر الفريق أول مارتن ديسمبى رئيس هيئه الأركان الحربية المشتركة الأمريكية لاتخاذ قرار بإلغاء المؤتمر الصحفي الذي كان مخصصا له لكي يلتقي من خلاله الصحفيين والإعلاميين المصريين.

وكان رئيس هيئة الأركان الأمريكية قد اضطر إلى إلغاء المؤتمر الصحفي بعد أن فشل في إقناع المشير حسين طنطاوي بقبول المقايضة التي قدمها والمتمثلة في إعفاء الـ19 متهما أمريكيا من المثول أمام محكمة الجنايات في قضيه تمويل منظمات المجتمع المدني بأموال مخابراتية أمريكية، والسماح لهم بمغادرة مصر إلى أمريكا مقابل استمرار المعونة الأمريكية لمصر.

ولم يستطع إلحاح رئيس الأركان في إثناء المشير طنطاوي عن موقفه المتمثل في حرية وسيادة واستقلال القضاء المصري.

وقال طنطاوي إنه لا يمكن التأثير عليه، وأنه يرفض من حيث المبدأ التدخل في أعمال القضاء ، مشيرا إلى أنه لا يقبل هذه المقايضة، مؤكدا أن مصر لا ترضخ لأية ضغوط، وهنا لم يجد رئيس الأركان الأمريكي بدا من إلغاء المؤتمر الصحفي، رغم أنه أبدى إعجابه بعملية التحول الديمقراطي الذي تشهده مصر بفضل جهود القوات المسلحة في بناء مؤسسات الدولة.


ــــــــــــــــــــــــــــــــــــــــــــــــــ ـــــــــــــــــــــــــــــــــــــــــ


هذا هو رد الجيش المصرى على رئيس أركان الحرب الأمريكى ... الرجل الأقوى فى العالم



هذا الرجل الذى يحرك الجيوش و الأساطيل الأمريكة حول العالم


جاء لإرهاب الجندى المصرى ...


فخرج .. أحمر القفاه و المؤخرة ...




نشكر جميع الزملاء على هذا الشعور الطيب إتجاه مصر العروبة



و لكن مهلاً يا رفاق العروبة ....


أمريكا لا تستطيع .... و أقولها لا تستطيع المساس بمصالحها فى مصر ..


و هذا هو الدليل .


النتن يا هو .. يتصل بأعضاء الكونجرس و يطلبهم بعدم المساس بالمعونة الممنوحة لمصر



السبب ...


تلغوا المعونة ... مصر تلغى كامب ديفيد ..


اللباس شايل راسين ... راس المعونة و راس الإتفاقية


و إل هيشد اللباس هتقع الراسين ..



مصر تملك أوراق ضغط أقوى من أوراق أمريكا ...


مصر تملك ... تحالف إيرانى تركى ....


هل تستطيع أمريكا و إسرائيل تحمل نتائج هذا التحالف ...



لا أعتقد ...



مدخلة سريعة .... بحبكم ... جداً


تحيا مصر


تحيا الأمة العربية
أحمد أبوزيد

وهذا رد الزعيم الخالد عبد الناصر قبل عشرات السنين


http://www.youtube.com/watch?v=unfyl737U0M

admin
02-24-2012, 05:20 AM
http://www.youtube.com/watch?v=xXXuIb2fC0Y

الشاعر لطفي الياسيني
02-24-2012, 05:24 AM
لا حبذا الله في حكام اوطاني/ الحاج لطفي الياسيني
--------------------------------------
لا بد من عودة للارض تحضنكم
بعد اغتراب هناك.. بغير اوطاني
هذي فلسطين والاقصى ومسجده
تاقت الى الاهل من قاص ومن داني
ارض الخليل...... لقد تاقت احبتها
من يوم هجرتهم.. لخليل رحمان
يبكي على الاهل لا احد يزور هنا
والجامع اليوم كم يشتاق خلاني
تاقت صلاة الضحى احباب جامعها
الى الشيوخ... لنسوان .. وشبان
نال اليهود من المحراب... واعتكفوا
في كل زاوية .. حاخام .....شيطان
قد قسموا مسجدا..... مذ باع قادتنا
غرف الصلاة .....الى موشيه دايان
اسفي على قادة... ما عاد يردعهم
غير الرصاص بساحات من الآن
خليل رحماننا في الاسر وا.. اسفي
عرب نيام ... بامريكا ... وقمران
لا حبذا الله........ في قادات امتنا
من بعد صدام .... صار الكل عدواني
باعوا البلاد لاجل المال.... وانكفأوا
في ذلهم في قصور .... مثل جرذان
خذهم قريبا اله العرش....قد عطشت
سقر اليهم... ونار جهنم......ثاني
---------------------------
الحاج لطفي الياسيني

اسماعيل الناطور
02-24-2012, 10:55 AM
أستاذ إسماعيل
أنا تعبت
صدقاً تعبت
لاأعرف هل أصرخ واطالبك بأن تخفي الحقائق
أن تتركني ومن هم على شاكلتي "نائمون بالعسل المر"!؟
أتدري سيدي؟؟.. وآسفة ان كان كلامي سيزعجك
بت أحسد من فقدوا عقولهم
وأخشى اني سأحسد من فقدوا حياتهم
بعد أن أصبحت أرى الصورة وكأننا"جرذان
كلما مر يوم ، كلما ضاقت علينا المصيدة
وإما ان نختنق أو نقتل بعضنا البعض، لنوفر نفس لغد جديد.. قديم
لايحمل سوى المزيد من التخبط والذل والعجز
لولا ان سب الدهر ، حرام
لفعلت مثل اى جاهل وقلتها بملء فمي وقلبي"ملعونــ......"
لاحول ولاقوة الا بالله
انفلونزا ماعز
ههههههه
" بالله لاتقل ، لاتضحكي رشا، عيب، لانسخر هنا، انا جاد"
أعرف أنك جاد، والله العظيم، أعرف أن الأمر جاد وخطير أيضاً"
ولكن دعني أسخر منه قبل ان يقتلني كمداً وقهراً
حاضر أستاذي سأحمل هذياني وأرحل عن الصفحة أفضل
ألا يوجد عطلة من المصائب والكوراث والهزائم يا سيدي
أرجوك سأطالب بعطلة
ليوم واحد فقط
لا بل ساعة واحدة
يا ااااالله



والآن
أصبح الهدف واضحا
القضاء على الثروة الحيوانية
قالوا العلف يسبب جنونا للبقر........فصدقتكم
قالوا .......إّذبحوا طيوركم فذبحتم
قالوا .......إذبحوا خنازيركم فذبحتم
والآن جاء دور الماعز والغنم
إن قالوا لكم إذبحوا أغنامكم............فإقطعوا ألسنتهم

إن صدقتكتموهم هذة المرة
فلن تروا اللحمة إلا في أحلامكم

لقد كتبنا هذا بتاريخ 26-9-2009
واليوم وصل كيلو اللحمة ببعض أحياء القاهرة إلى 90 جنيها مصريا
ولقد حذرنا مما وراء حملات إنفلونزا الطيور والخنازير وجنون الأبقار
ولكن كان السمع ثقيلا...........
لا حول ولا قوة إلا بالله
والله أكبر
المهم هناك حملة لمقاطعة الجزارين في الخامس من إبريل
فهل هذا هو الحل ؟


وكانت الحملة على البريئ الجزار ولم تكن على المجرم المصدر والمستورد ولكنها كانت تجارب ناجحة لليد الماسونية في دراسة نفسية الشعب إثناء التظاهر ونفسية وطرق تعامل الحكومة مع هذا الشكل من التنظيم

اسماعيل الناطور
02-25-2012, 10:40 AM
لو لم تقل هذه الجملة لقلت أنك لست بمحلل سياسي أو إجتماعي
! بعدما قرأت مداخلتكم رقم ( 7 )

و لذلك قرأتها من باب عتابك و غيرتك و ربما شيئا من الإحباط
على مجلس تتمنى
أن تكون خطواته أكثر سرعة


طلب إحاطة رقم 1 من مواطن عربي
مشاركة بتاريخ 5 ابريل 2010م من ضمن موضوع الخامس من إبريل-وتأديب الجزارين
http://www.almolltaqa.com/ib/showthread.php?52913-%C7%E1%CE%C7%E3%D3-%E3%E4-%C5%C8%D1%ED%E1-%E6%CA%C3%CF%ED%C8-%C7%E1%CC%D2%C7%D1%ED%E4

قبل تسعة سنوات
قرار وزاري بحظر استيراد المشروبات الغازية ولحوم الدواجن من دول الاتحاد الأوروبي
قرار وزاري رقم(1197) وتاريخ 15/5/1423هـ
إن وزير التجارة،
بناء على الصلاحيات المخولة له،
وبعد الإطلاع على نظام اختصاصات وزارة التجارة الصادر بقرار مجلس الوزراء رقم(66) وتاريخ 6/4/1374هـ وعلى نظام مكافحة الغش التجاري الصادر بالمرسوم الملكي رقم م/11 وتاريخ 29/5/1404هـ ولائحته التنفيذية.
وبعد الإطلاع على النظام الأساسي للهيئة العربية السعودية للمواصفات والمقاييس الصادر بالمرسوم الملكي رقم م/10 وتاريخ 1392هـ.
وعى قرار مجلس الوزراء رقم (50) وتاريخ 17/3/1410هـ المتضمن تحديداً للسلع والمنتجات المستوردة والمناط فحصها وفسحها من قبل مختبرات وزارة التجارة.
والأمر السامي رقم خ/ب/17257 وتاريخ 17/12/1421هـ القاضي بالتعامل بمنتهى الحرص واليقظة والجدية والإحساس الكامل بالمسئولية واتخاذ جميع الإجراءات الاحترازية والوقائية لمنع تسرب أي من المنتجات المشكوك في سلامتها والتي تهدد مخاطرها صحة الإنسان.
وبناء على ما ورد من الجهات الرسمية المختصة من أن الوكالة البلجيكية للأمن الغذائي أعلنت عن اكتشاف هرمون MPA (Acetat de medroxy-Progesterone) وهرمون (Ostradiol)، التي تسبب الإصابة بالسرطان في أغذية حيوانية وفي المشروبات الغازية وأن الاختبارات العلمية كشفت أن خمسة عشر دولة في الاتحاد الأوروبي من بينها بلجيكيا وإيطاليا وهولندا وألمانيا وأسبانيا وايرلندا تستخدم هرمونات (ستيريوديه) غير مشروعة في علف حيوانات إنتاج اللحوم وكذلك في المشربات الغازية، وهي هرمونات تسبب السرطان والعقم،

لا تزال أنواع جديدة تكتشف من الاستروجين
وأهم هذه الأنواع الاستراديول-17ب
واستراديول
والأوسترون
وأسترول.
هذا وأن جميع الاستروجينات من مركبات ستيروئيدية، أهم مصدر طبيعي لها المبيض وقشر الكظر، وخلايا لايدغ في الخصية، والمشيمة، وتختلف فعلية الاستروجين الفيزيولوجية والفارماكولوجية من نوع استروجين لأخر وأكثرها قوة الاستراديول 17 ب ويأتي بعده الاوسترون والاسترويول.
التأثير الفارماكولوجي للاستروجينات:
إن الأنوثة عند الطفل لا تتم إلا بتأثير الكمية الوفيرة من الاستروجين حيث يزداد نمو النسج التناسلية ويزداد حجمها ونضجها كذلك يزداد النمو والتطور في عضلات الرحم وبطانة الرحم. ويؤثر الاستروجين على نسيج الجهاز التناسلي في الذكور والإناث.
وفي الرحم بخاصة في غشاء باطن الرحم تزداد كمية الماء والشوارد والبورتئين والنوكليئيدات وعدداً من الخمائر، يتكثف الغشاء المخاطي للمهبل نتيجة زيادة الغليكونجين في خلايا الغشاء المخاطي حيث يتكون منه حمض اللبن تحت تأثير عصيات دودرلاين, وكل من كثافة الغشاء المخاطي وزيادة الحموضة والتقرن يؤدي إلى زيادة مقاومة المهبل تجاه العوامل الممرضة، هذا وإن مفرزات الجماع والإثارة الجنسية تنقص عند نقص الاستروجين وتزداد عند زيادة الاستروجين.
وللاستروجين تأثير واضح على عنق الرحم إذ يحوله إلى غشاء ناضج محتقن مليء بالمفرزات والماء. أول هرمون ينبه نمو الثدي هو الاستروجين
إن توزع الدسم والشحوم عند النساء يخضع لتأثير الاستروجين.
ويدعم الاستروجين زيادة توضع الدسم تحت الجلد.
ويزيد الاستروجين من كثافة الجلد ومن احتوائه للماء.
http://www.alnajafalashraf.net/magtwentyseven/images/n27mela4.jpg
هو يعاكس تأثير الاندروجين الذي يزيد فعالية الغدد الدهنية في الجلد وزيادة مفرز الدهن الجلدي في الوجه والظهر لذا فضل لمعالجة العد الشبابي.
أما خارج الجهاز التناسلي فقد لوحظ أن الاستروجين قد يؤخر نسبة النمو اذ لوحظ أن نسبة النمو وسرعته قبل البلوغ تكون أشد مما بعد البلوغ خاصة في الأطراف. وفي مرحلة الكهولة الأولى يتركز النمو في الجذع خاصة. ويلاحظ في حالات فرط الاستروجين أن نسبة النمو تبطؤ. ولوحظ أن تأخير الارتفاع المتسارع للاوستروجين في مرحلة البلوغ يؤخر فترة البلوغ ويطيل فترة النمو معها. والمرأة ذات البلوغ المتأخر غالباً ما تكون ذات أطراف طويلة. وبالعكس فإن البلوغ السريع المبكر يترافق معه أطراف قصيرة نسبية.
للاوستروجين تأثير استقلابي هام – وتأثير استقلابي بروتيني إيجابي خاصة في النسج المحيطية والأعضاء التناسلية المحيطية ويؤثر على البروتين لذلك عند قصور المبيض ونقص الاستروجين يلاحظ توازن بروتيئيني مضطرب ونقص اللحمة العظمية أو الفراش العظمي خاصة في الفقرات.
ويؤدي هذا النقص إلى تثقب العظام، وغالباً ما نجد هذا بعد سن اليأس لتراجع وظيفة المبيضين. أو بعد استئصال المبيض عند الشابات أو غياب المبيضين واشعاعهما.
وقد يكون بسبب قصور نخامي. إن تثقيب العظام ليس سببه النقص الاستروجيني فقط وإنما هرمونات أخرى منها هرمونات قشر الكظر التي لها تاثير مخرب معاكس للاستروجينات. ويزيد الاستروجين نسبة هرمون الدرق المتحد بالدم مع البروتئين ونسبة اتحاد هرمونات قشر الكظر المتحدة مع البروتين في الدم.
لا نزال نجهل الآلية التي تؤثر فيها الاستروجينات, إنما نعلم أنه يؤثر في النسيج المحيطية ويعتقد أن له مراكز تقبل بروتينية خاصة. وخاصة فإن الرحم لها قدرة على تحويل الاوسترون إلى استراديول ويغلب على الظن أن الآلية تتركز حول تركيب الحامض النووي.

اسماعيل الناطور
02-25-2012, 11:51 AM
[b][size=6][font=traditional arabic]ذات الأمر للأسف تراه هنا ، فرغم أن مواقف سورية كانت معاكسة لمواقف "كامب ديفيد" الأول و"كامب ديفيد" الثاني ، ومعاكسة لمواقف "أوسلو" الأول و"أوسلو" الثاني ، ومعاكس لمواقف "وادي عربة" الأول و"وادي عربة" الثاني ، إلا أن ذلك لا يعني لبعض الأخوة شيئا ، ويستمر نصيب "الأسد" الأول و"الأسد" الثاني هو ذاته وخاصة ممن اكتوى بنار هذه المعاهدات ذاتها وما زال كذلك إلى الآن

نرفض مواقف "كامب ديفيد" الأول لكن إن رفضها حافظ الأسد فإننا نقبلها ، كيف ولماذا لا يهم
نرفض مواقف "أوسلو" الأول لكن إن رفضها حافظ الأسد فإننا نقبلها ، كيف ولماذا لا يهم
نرفض مواقف "وادي عربة" الأول لكن إن رفضها حافظ الأسد فإننا نقبلها ، كيف ولماذا لا يهم
نرفض مواقف "كامب ديفيد" الثاني لكن إن رفضها بشار الأسد فإننا نقبلها ، كيف ولماذا لا يهم
نرفض مواقف "أوسلو" الثاني لكن إن رفضها بشار الأسد فإننا نقبلها ، كيف ولماذا لا يهم
نرفض مواقف "وادي عربة" الثاني لكن إن رفضها بشار الأسد فإننا نقبلها ، كيف ولماذا لا يهم




ويستمر الألم مهما حاولنا أن نخفيه في الوجدان , والألم قد يكون مضاعفا لأن المتصدين يشوهون وجه المنطق الإسلامي الذي وظفوه لخدمة السياسة وقبحها , فعندما أجد من يستغل الأخ اسماعيل هنية ويضعه خطيبا في الأزهر الشريف لا من أجل فلسطين والحق , بل من أجل وضع البنزين على النار في سوريا , الأخ اسماعيل هنية وقادة حماس أجدهم أيضا يتلاعبون بالمشاهد ويشترون السياسية بأمانة المصداقية الإسلامية , الإسلام يدعو لرد الجميل والوفاء , فمن قادت الدفاع عن غزة إثناء إشتعالها بالفسفور الأمريكي والصهيوني كانت سوريا الأسد , واليوم ومن أجل الصفقات والمعونة من دوائر معينة , يسمح الأخ اسماعيل هنية لنفسه أن يقف خطيبا في الأزهر في جو من النداءات والشعارات ضد حزب الله الذي أذل إسرائيل ولهدم سوريا وإضعاف الأسد الذي قد وصل اليوم إلى نهاية القرار, فإما القضاء على المؤامرة وإلا دم لن تستفيد منه غزة ولن ينفعها من وضعوها في هذا المأزق الأخلاقي , لقد كانت صدمتي كبيرة في ياسر عرفات عندما سمح لنفسه معاداة الكويت أيام الغزو , كانت الصدمة لأن على القائد الفلسطيني أن يلتزم وبكل قوة البعد عن التدخل في شأن أي بلد عربي أو إسلامي , نحن شعب جار علينا الزمن , ونطلب من الجار والصديق والبعيد أن يقف معنا , لذلك يجب أن تكون كلمة القائد تحت ألف حساب لأن الضحية سيكون الشعب الفلسطيني , في الكويت دمر ياسر عرفات الجالية الفلسطينية هناك , فهل نسى ذلك اسماعيل هنية وقادة حماس , هل فضلوا المعونة لغزة عن المعونة السورية للشعب الفلسطيني هناك , التألم كبير لإنه يتطابق مع الغباء الأكبر , ولكن أتمنى أن تكون القيادة السورية والشعب السوري قد توصلت إلى نفس نتيجتك أن المهم المواقف الحقيقية وليس بيع الكلام لكسب المواقف وإنقاذ ما يمكن إنقاذه , إن غزة في مأساة قطع الكهرباء وأقدر جدا من دفع ومول عودة الكهرباء إلى غزة وتصدى للحصار ......ولكن كنت أتمنى أن يكون الموقف أخلاقيا ويتوافق من الإسلام الحقيقي وليس الأسلمة السياسية

اسماعيل الناطور
02-25-2012, 10:35 PM
ويستمر الألم فهناك من سرق منا حلم الثورة, الثورة الحقيقية التي كان ينتظرها المواطن العربي من الخليج إلى المحيط, الثورة على الحكام الذين سمحوا للعلم الإسرائيلي أن يرفرف على بعض العواصم, الثورة على الحكام الذين أهدروا مال الشعب وطاقاته وحولوا المجتمع العربي إلى مجتمع مستهلكك لا زراعة تكفي ولا صناعة منافسة ولا قوات وجيوش تصنع أسلتحها وقطع غيارها, الثورة على الحكام الذين خصبوا الغباء في التعليم والثقافة ومستوى الوعي وحصانة الشباب لكل ما هو قادم ورديء , الثورة على الانفتاح اللامسئول , الثورة على القهر ومساكن التشرد والعشوائيات والبطالة , نعم هناك من سرق الثورة الحلم و يحاول أن يقدم لنا ربيعا لا يسأل عن كل ما ذكرت , وهمه الوحيد حرية الشتم وقلة الأدب , حرية الفوضى وتعطيل التنمية , حرية الاختيارات ولو كان من بنودها العمالة الواضحة والتمويل الأناني وبيع الضمير وأن الوطن ممكن بيعه بمنصب أو شيك برصيد مجهول النسب والهدف , انتظرنا الثورة على القطيع , فقز قطيع آخر على ما يبدو إنه لا فرق بينه وبين القطيع البائد , كنت أقول سطحية بعد الكراسي , ولكن وعلى ما يبدو إنها سطحية متعمدة ليبقى سكان القطيع في نفس الحال أو أسوأ

اسماعيل الناطور
02-25-2012, 11:20 PM
هل إكتشفت حماس فجأة أن الممانعة السورية في ظل نظام الأسد
لم تكن سوى متاجرة بالقضية ؟
أم أنها إكتشفت ان نظام الأسد يلفظ أنفاسه الأخيرة ؟



الأخ محمد برجيس ...فعلا أنا أتألم لواقع السياسة وما فيها من نذالة , ولن أضيف أكثر مما كتبت في موضوع السطحية الإستراتيجية , ولكن سأضيف جملة
قيادة حماس دقت مسمارا في نعش المصداقية , ولسوف يندم الكل عندما تعود سوريا وبقيادة الأسد قريبا , لو نظرت إلى إجتماع تونس ومبررات إنعقاده , لوجدت أن المؤامرة على سوريا تلفظ أنفاسها الأخيرة , فلن تجدي الحرب النفسية ولن تقدم يوما لحياة المؤامرة التي أصبحت في يقين الشعب السوري , الكذبة أكبر وقعا على من هم خارج سوريا , بينما من هم بالداخل ويعلمون إنها كذبة يزداد صمودهم , هل تعلم مدى سذاجة قصة باب عمرو في حمص ؟ ...إذا أردت أن تستوعب كبر الكذبة فإستمع إلى من يقول يوميا أن الطائرات والمدفعية والدبابات والصواريخ تقصف باب عمرو يوميا ولو صدقنا الجزيرة وشاهد عيان وإستخدام هذه الأسلحة ولمدة تزيد عن شهر لكانت حمص كلها وليس باب عمرو الحارة الصغيرة أنقاض وليس فيها أحد يصرخ يوميا ويقول ...طائرات صواريخ دبابات ...الغباء ليس هبة ولكن الغباء إختيار

اسماعيل الناطور
02-26-2012, 08:31 AM
وكان أهم استنتاج من تجربة صراع أوروبا مع المسلمين ،سواء في الأندلس وفي حملة نابليون وفي احتلال بلاد الشام ، هو مبدأ "فرق تسد" ، وأن العدو المفكك والمتفرق والجاهل يهزم نفسه بنفسه ، فبدلا من أن يهاجم نابليون مصر ثم يهزم في عكا ، تساعد أوروبا محمد علي كي يهاجم الشام ثم تساعد السلطان على حربه ضد محمد علي كي يهزمه ،( وهذا ما أدى إلى زيادة كبيرة في تقطيب الأمبراطورية العثمانية بين قوميين عرب وأتراك يكرهزن بعضهم وبين إسلاميين متمسكين بالخلافة )، فكان أن تابعت أميركا مشروع بريطانيا لفصل الشام عن مصر بقاعدة عسكرية ضخمة وقودها اليهود ، ومتابعة تفريغ العالم العربي من العقول ، وزيادة تفتيت المجتمع بين قوميين وإسلاميين ، وإقامة ملكيات وراثية دينية متناحرة ، ومثل أي مشروع مكتمل الدراسة يجري نقله من متعهد إلى آخر ، تابعت بقايا الإمبراطورية العثمانية ، وبشكل غريزي غير واع ، عملية الإستقطاب فمال القوميون إلى معسكر الشرق ومال الإسلاميون إلى معسكر الغر
سأركز على هذا الجزء من الإقتباس لإنه هدف الموضوع وقد لونت بالأحمر مبدأ فرق تسد -نابليون-بريطانيا-بقايا الأمبراطورية العثمانية -أمريكا لإنه فعلا مشروع يتنقل من متعهد لآخر , وكان سؤالي والتاريخ الذي وضعته عنوانا لهذا الموضوع للبحث والإجابة عن سؤال
من هو صاحب المشروع ؟
ومن هي تلك الحكومة الخفية التي تدير هذا المشروع وتتنقل به من مقاول لآخر ؟
لذلك بحثت مستخدما طريق آخر بسؤال آخر ....
ما تزال أمريكا أكبر دولة دولة مديونة ويلاحقها الإفلاس ولذلك تظل في سباق مع الزمن لنهب مال الغير
فمن هو الدائن والذي يمسك هذا العالم من رقبته ويسيره كما أراد ؟
لأنني أعتقد إننا لو كشفنا عن الدائنين وأسماءهم وجنسياتهم وأديانهم ومحل إقاماتهم, يمكننا بسهولة أن نفهم
بدل البحث في الفراغ عن عدو وهمي وإقامة مهرجانات التحليل السياسي كلما جاءت إنتخابات رئيس أوذهب رئيس
والتجربة أفادت أن الرئيس القادم ما هو إلا صورة من الرئيس السابق في خدمة المشروع
وما يحدث فعلا هو مع الأسماء والأقنعة .....فهذا رأسمالي وهذا شيوعي وذاك صهيوني......... وهذا رجعي وهذا تقدمي ....وهذا فوضوي......
ويبقى الإنسان المواطن يتعثر من حفرة إلى أخرى حتى لم يعد له بصر ولا وعي من التعمد بالكذب عليه ليلا نهارا

اسماعيل الناطور
02-26-2012, 08:37 AM
هل تنجح أمريكا فعلا في جر الصين وروسيا لمواجهة لتحجيمهما ولتقليص نفوذ الصين التجاري وسرقة أسواقها بالقوة ..؟

هل الأمور بهذه البسيطة كما يتخيلها كسينجر ..؟

هل تقوم أمريكا بأعمال أخرى غير البلطجة العسكرية لتحجيم الصين واحتواء روسيا سياسيا في العالم ..؟ أم أن الخيار جاد كما يقول كسينجر .. ؟

هل منطقتنا مهيأة لهذا الحدث وهل المخلصون يستشرفونه؟ وما تأثير مجريات الأحداث القادمة على الربيع العربي ..؟

أرى أن السؤال قد يراه أحدهم بطريقة أخري
هل تنجح(قوى المال الماسونية ) فعلا في جر الصين وروسيا لمواجهة مع(الغرب المسيحي ) لتحجيمه ولتقليص نفوذه التجاري وسرقة أسواقه بالقوة ( بعد ضرب الإسلام بأهله وبمساعدة الغرب المسيحي ) ..؟
http://www.youtube.com/watch?v=gjjDQ9e_bx4t

http://www.youtube.com/watch?v=bQwZotJlXzQ#!


http://www.youtube.com/watch?v=1rENmNep55E
http://www.youtube.com/watch?v=vT7OIPLya7c

http://www.youtube.com/watch?v=JqQVKgjqm7w
http://www.youtube.com/watch?v=oen8uwWAJ2o
http://www.youtube.com/watch?v=iOkfnNT5R1w

http://www.youtube.com/watch?v=fLqRkjaxadY

اسماعيل الناطور
02-26-2012, 11:10 AM
يا شعب مصر أبحثوا عن مصدر هذه الاموال ( لجمعة إصرار إبليس )

وإقرأ كيف يتلاعبون بمشاعر الناس ..فعندما لم يجدوا فرصة الدستور اولا وإلغاء المادة الثانية للدستور ...


كثَّفت حركة "شباب 6 أبريل"، جهودها لحشد المواطنين للمشاركة فى المظاهرات والاعتصام المفتوح اللذان دعت إليهما يوم الجمعة المقبل تحت شعار "جمعة الإصرار.. الفقراء أولا"، حتى يتم تنفيذ مطالب الثورة.
وقالت إن أهم هذه المطالب هي المحاكمات العاجلة والعلنية لمبارك وكل رموز الفساد فى النظام السابق، ومحاكمة ضباط الشرطة وكل المتورطين فى إطلاق الرصاص على الثوار، ومراجعة القوانين التى تم إصدارها بدون عمل حوار مجتمعى حولها، وحرية الإعلام والصحافة وتطهير المؤسسة الإعلامية (الرسمية)، ووقف المحاكمات العسكريه للمدنيين، وتطهيرالوزرات والمؤسسات المختلفة، ووضع حدين أدنى وأقصى للأجور.
ووزع شباب الحركة فى مناطق "مصر الجديدة" و"مدينة نصر" و"وسط البلد" و"العجوزة" و"إمبابة" و"بولاق" و"الدقى" و"الهرم" بالقاهرة الكبرى، 50 ألف منشور دعوا فيه المواطنون للمشاركة فى فعاليات الجمعة المقبل.
كما قاموا بتوزيع آلاف الدعوات أمام محطات المترو بمنطقة الزيتون والمعادى وعين شمس والمطرية، وكتابة جداريات "الثوره مستمرة موعدنا 8 يوليو"، وفى الإسكندرية قام شباب الحركة بتوزيع مايقرب من 90 ألف منشور خلال اليومين السابقين، من بينها 10 آلاف دعوة تم توزيعها أمس الأول بمناطق العجمى والمنتزه، إضافة إلى استخدام وسائل غير تقليدية فى الدعوة لجمعة "الإصرار" مثل تسجيلات الفيديو المصورة والوقفات الصامتة.
وفى الإسماعلية، وزع شباب الحركة 20 ألف منشور.وأعلنت إنجى حمدى المنسقة الإعلاميه بالحركة أن الحركة بصدد توزيع ما يقرب من 100 ألف منشور أخرى بالقاهرة وعدد من المحافظات المختلفة، قائلة "علينا أن نعى أن الشعب هو الأقوى وأننا نملك الإرادة الكاملة لتحقيق ما نريده".
وأكد أحمد ماهر المنسق العام للحركه على أن سلمية الدعوات للاعتصام المفتوح والمظاهرات فى جمعة "الإصرار.. الفقراء أولا"، تدحض ما أثير من "أكاذيب" روج لها تقرير لقطاع الأمن العام ونشرته وسائل الإعلام، بشأن إرهاب المواطنين للمشاركة فى جمعة "الإصرار.. الفقراء أولا"، مشددا على استمرار الخط السلمى للحركة.
http://profile.ak.fbcdn.net/hprofile-ak-snc4/276941_207954075914799_4983157_s.jpg

وضعنا هذا النداء بتاريخ 5-7-2011م
واليوم تبدأ المحاكمة ...محاكمة عملاء التمويل الأجنبي

اسماعيل الناطور
02-26-2012, 11:10 AM
يا شعب مصر أبحثوا عن مصدر هذه الاموال ( لجمعة إصرار إبليس )

وإقرأ كيف يتلاعبون بمشاعر الناس ..فعندما لم يجدوا فرصة الدستور اولا وإلغاء المادة الثانية للدستور ...


كثَّفت حركة "شباب 6 أبريل"، جهودها لحشد المواطنين للمشاركة فى المظاهرات والاعتصام المفتوح اللذان دعت إليهما يوم الجمعة المقبل تحت شعار "جمعة الإصرار.. الفقراء أولا"، حتى يتم تنفيذ مطالب الثورة.
وقالت إن أهم هذه المطالب هي المحاكمات العاجلة والعلنية لمبارك وكل رموز الفساد فى النظام السابق، ومحاكمة ضباط الشرطة وكل المتورطين فى إطلاق الرصاص على الثوار، ومراجعة القوانين التى تم إصدارها بدون عمل حوار مجتمعى حولها، وحرية الإعلام والصحافة وتطهير المؤسسة الإعلامية (الرسمية)، ووقف المحاكمات العسكريه للمدنيين، وتطهيرالوزرات والمؤسسات المختلفة، ووضع حدين أدنى وأقصى للأجور.
ووزع شباب الحركة فى مناطق "مصر الجديدة" و"مدينة نصر" و"وسط البلد" و"العجوزة" و"إمبابة" و"بولاق" و"الدقى" و"الهرم" بالقاهرة الكبرى، 50 ألف منشور دعوا فيه المواطنون للمشاركة فى فعاليات الجمعة المقبل.
كما قاموا بتوزيع آلاف الدعوات أمام محطات المترو بمنطقة الزيتون والمعادى وعين شمس والمطرية، وكتابة جداريات "الثوره مستمرة موعدنا 8 يوليو"، وفى الإسكندرية قام شباب الحركة بتوزيع مايقرب من 90 ألف منشور خلال اليومين السابقين، من بينها 10 آلاف دعوة تم توزيعها أمس الأول بمناطق العجمى والمنتزه، إضافة إلى استخدام وسائل غير تقليدية فى الدعوة لجمعة "الإصرار" مثل تسجيلات الفيديو المصورة والوقفات الصامتة.
وفى الإسماعلية، وزع شباب الحركة 20 ألف منشور.وأعلنت إنجى حمدى المنسقة الإعلاميه بالحركة أن الحركة بصدد توزيع ما يقرب من 100 ألف منشور أخرى بالقاهرة وعدد من المحافظات المختلفة، قائلة "علينا أن نعى أن الشعب هو الأقوى وأننا نملك الإرادة الكاملة لتحقيق ما نريده".
وأكد أحمد ماهر المنسق العام للحركه على أن سلمية الدعوات للاعتصام المفتوح والمظاهرات فى جمعة "الإصرار.. الفقراء أولا"، تدحض ما أثير من "أكاذيب" روج لها تقرير لقطاع الأمن العام ونشرته وسائل الإعلام، بشأن إرهاب المواطنين للمشاركة فى جمعة "الإصرار.. الفقراء أولا"، مشددا على استمرار الخط السلمى للحركة.
http://profile.ak.fbcdn.net/hprofile-ak-snc4/276941_207954075914799_4983157_s.jpg

وضعنا هذا النداء بتاريخ 5-7-2011م
واليوم تبدأ المحاكمة ...محاكمة عملاء التمويل الأجنبي

اسماعيل الناطور
02-26-2012, 01:34 PM
المنظمات الأمريكية سعت للوقيعة بين المصريين
أما صحيفة الأهرام المصرية فقالت إنها "تنفرد" بنشر أدلة تثبت بأن "المنظمات الأمريكية سعت للوقيعة بين المصريين ومؤسسات الدولة،" وأضافت "حصلت الأهرام على أدلة الثبوت في قضية التمويل الأجنبي لمنظمات المجتمع المدني‏،‏ المحالة إلى محكمة الجنايات‏،‏ والمتورط فيها ‏43‏ من مديري وأعضاء تلك المنظمات‏."
وأضافت الصحيفة "أكدت مساعدة وزير الخارجية المصرية لشؤون حقوق الإنسان في شهادتها، أن التصريح الوحيد الذي حصل عليه المعهدان الجمهوري الدولي، والوطني الديمقراطي، خاص بمتابعة الانتخابات البرلمانية الأخيرة، إلا أنهما تماديا في ممارسة أعمالهما في الشأن السياسي الداخلي الوطني، برغم الحظر الصريح الذي يمنعهما من ممارسة ذلك النشاط."
ومضت الصحيفة تقول "أوضح أحد كبار ضباط قطاع الأمن الوطني المكلف بجمع التحريات، أن المعهدين الجمهوري الدولي، والوطني الديمقراطي، ومؤسسة فريدوم هاوس، نظمت 387 ورشة عمل خلال مدة وجيزة، عقب اندلاع ثورة يناير، وجميعها ذات صلة بالمجالات السياسية والحزبية لمصر، ولا تمت بصلة للأعمال الحقوقية أو الإنسانية التي تعتبر من صميم أعمالهم."
وفيما يختص بمنظمة فريدوم هاوس، أكد مسؤول التحريات، أن "هذه المنظمة كان هدفها الرئيسي بث حالة عدم الثقة بين أوساط المواطنين، والتحريض بجميع الطرق ضد الدولة ومؤسساتها، خاصة الإستراتيجية، وذلك بتبني بعض القضايا الشائكة والحساسة، مثل رصد المستويات الاجتماعية والإنسانية للأقباط، وأبناء النوبة داخل البلاد، والعمل على إثارة قضاياهم ومشكلاتهم في الشارع المصري بشكل تحريضي،" وفقاً للصحيفة.

اسماعيل الناطور
02-26-2012, 04:42 PM
على رأي ونغمات أنت فين والحب فين أو ممكن أنت فين والثورة فين
قدم النائب مصطفى النجار بطلب إحاطة عاجل إلى المشير محمد حسين طنطاوي بصفته وزير الدفاع، واللواء محمد إبراهيم، وزير الداخلية، للمطالبة بالفتح الفوري لشوارع منطقة وسط البلد ومحيط البرلمان وإزالة الحواجز الخرسانية لإعادة الحياة إلى هذه المنطقة الحيوية في العاصمة, يعنى الواد خايف على المرور ومش خايف على وسط البلد اللي بهدلوه مليونيات بمناسبة وبدون مناسبة , نفسي يكون رد رئيس المجلس ....إحنا مش فاضيين للعب العيال وبلاش من مسلسل غرام وإنتقام , هناك أهم يا سعادة النائب ....مثلا طلب إحاطة حول تمويل حملتك الإنتخابية !!!!!!

اسماعيل الناطور
03-09-2012, 01:45 PM
اليوم
جمعة إسترداد الكرامة المصرية
اليوم
جمعة طرد السفيرة الأمريكية من القاهرة
اليوم دعوة شرفاء
فهل يستجيب شعب مصر!!!

اسماعيل الناطور
03-09-2012, 02:14 PM
كمال الهلباوي وعلى قناة سي بي سي يفتي :
أن الإعتصام في ميدان التحرير هو فرض عين إلى أن يتحقق مطالب المعتصميين بتسليم السلطة لمجلس مدني
فهل الإخوان تناسوا أمانة المسلم من أجل اللعب السياسي!!!!!
فأنا الاحظ أن قادة الأخوان وضعوا يدا مع البرادعي
ووضعوا اليد الأخرى مع المجلس العسكري الأعلى ...
فلقد كانت هناك إشاعات وقد نقلتها في مشاركة سابقة
أن الأخوان إتفقوا مع البرادعي وما يمثل
-مجلس الشعب للإخوان
-والرئاسة للبرادعي
كذلك هناك إشاعات قد نقلناها أيضا سابقا أن هناك إتفاق آخر مع المجلس العسكري
إنجاز الانتخابات في موعدها
في مقابل مقاومة الهجوم على أدارة الفترة الإنتقالية وتركها للجيش حتى إنتخاب الرئيس المباشر من الشعب
لدرجة أن يستعد ليكون بديلا للشرطة في حماية الميدان
.....يجرى هذا والشعب لا زال ينادي عيش ..حرية
وهنا أفهم لماذا كان أول قرارات ثورة يوليو وعبد الناصر إلغاء الأحزاب

فهل يشارك الأخوان اليوم
وهل الفتوى هي فتوى دينية أم فتوى بيع وشراء
ننتظر ونراقب ونسمع ونشاهد سيناريو هذا اليوم

اسماعيل الناطور
03-09-2012, 02:37 PM
الجزيرة (حمار) مباشر

http://i.aksalser.com/u101106/98823071.jpg
موجز النشرة






سلمي يستعيد وعيه و يسأل
هل جمعة الإنتفاضة الكردية التي تشاركنا فيها الجزيرة الآن
تشاركنا فيها أيضا إخوتنا أكراد تركيا ورمزنا المخطوف أوجيلان
أما أن أكراد سوريا هم غير أكراد تركيا في عين إسطنبول وحمير المجالس

اسماعيل الناطور
03-09-2012, 03:04 PM
قالها ..ما أخذ بالقوة لا يسترد إلا بالقوة ..
وغادرنا ..
.الزعيم الراحل ابو خالد ...
http://www.marefa.org/images/thumb/9/9e/riad_naser.jpg/300px-riad_naser.jpg
وفي السادس من اكتوبر العاشر من رمضان كان قرار بالحرب لإسترجاع الكرامة
كان اول قرار بالحرب يتخذه زعماء عرب في عصرنا الحديث
رحمة الله عليه الزعيم الراحل محمد انور السادات
ورحمة الله عليه الزعيم الراحل حافظ الأسد
http://raaskettan.files.wordpress.com/2008/11/hafez-_09.jpg
كان لدينا رجال
كان لدينا زعماء عرب ..
.كان هناك كرامة ونخوة وأصالة
الزعيم الراحل الملك فيصل عبد العزيز آل سعود
الزعيم الراحل الرئيس هواري بومدين ....
وفي لحظة فخر إقتحم جنود مصر خط بارليف
وإقتحم جنود سوريا هضبة الجولان
وإنتهت أسطورة الجندي الإسرائيلي الذي لا يقهر ...عندما رفع الجندي محمد محمد عبد السلام العباسي علم مصر على خط بارليف




http://wata1.com/vb/picture.php?albumid=8&pictureid=40
الغريب أن هذا الرجل تقدم لطلب الحج فكان الرفض من نصيبه من عسكري في نظام مبارك
وإلى لقاء مع صباح الخير يا كرامة


اليوم يوم الشهيد الحقيقي وليس شهيد الفضائيات والشبيحة
إنه يوم شهيد الوطن
عبد المنعم رياض يرحمك الله

admin
03-09-2012, 09:39 PM
رحم الله شهداء الامة الابرار
وألف رحمة تتنزل على روح الشهيد البطل
عبد المنعم رياض

"ومنهم من قضى نحبه ومنهم من ينتظر ومابدلوا تبديلا "

تحية تليق

اسماعيل الناطور
03-10-2012, 09:03 AM
تعلم جيدا يا أ إسماعيل كم أقدر تحليلكم ووعيكم في تناول القضايا التي تطرحونها بموضوعاتكم
و لكن الإختلاف سنة الكون و لعلك تدرك جيدا أنني كنت معارضا لتحيللاتكم و وجهة نظركم
حيال الثورة المصرية و لكن عندما أتت الأحداث بما توقعتموه تماما و كذلك ما رأيته من تغيير
لمواقف الثوار بعد الثورة فلم يكن بوسعي إلا ان صرحت لكم بأنني كنت مخطئ لأنني تسرعت
في الحكم على وجهة نظركم ؟

و لكن بموضوع سوريا فالأمر مختلف جملة و تفصيلا فأنا أتحدث عن ( قتل ) أبرياء
سواء من ثوار او متثورين او من الجيشين سواء الحر أو النظامي . و احمل النظام مسؤولية
تلك المجازر و إرتفاع حصيلة القتلى .... بينما انت لاترى سوى قتلى من طرف واحد فقط
بينما تغض الطرف عما يحدث للطرف الأخر و كأن من يزفون يوميا للقبور درجات
درجة مميزة من النظام و درجة ترسو ممن هم ضده و كانهم ليسوا بشرا .

و لذلك سأختلف معك على طول الخط بالشان السوري ... و لكن هذا الإختلاف أبدا لن يفسد
او يطيح بأستاذيتك لي فيما تطرحونه من موضوعات و تلمذتي بمدرستكم في التحليل الدقيق لما تتناولونه من أفكار ..... فالإختلاف في الرأي لن يفسد ما بيننا من مودة مطلقا !



الأخ محمد برجيس
الدم غالي على أصحابه , والروح مقدسة , وجزاء المعتدي العقاب ولو حتى كان الإعتداء من شخص على نفسه ,فلقد حرم الله الإنتحار وكان عقابه شديدا , لذلك فإن قتل النفس البريئة جريمة لا تغتفر لا أخلاقيا ولا إنسانيا ولا دينيا , ولكن الجهة الأخرى للموضوع هو أمر الله وأمر الدفاع عن الوطن ( بسم الله الرحمن الرحيم ..وكتب عليكم القتال وهو كره لكم ...) وهنا يكون القتل بمعنى الشهادة والنصر ...
ونأتي لما يحدث في سوريا , إذا نظرنا للقتل على أن النظام يقتل لمجرد أن يتمسك بالسلطة فهو قتل بشع وجريمة , أما إذا كان النظام قد أجبر على دخول معركة هدفها تدمير سوريا وجيشها وأمنها وتقسيمها فهو قتل يدخل في نطاق وكتب عليكم القتال وهو كره لكم , وهنا يكون القتل بمعنى الشهادة والنصر , لذلك كنا ولا زلنا ندعو إلى تعريف الشهيد حتى في مصر , فهل الضابط الذي دافع عن مكان عمله كان قاتلا ؟ أما المتظاهر أو القادم إليه والذي جاء يعترض على مبارك ولم يجد إمامه إلا جندي أمن مركزي غلبان يضربه بعصا أو حجر أو مقر حكومي يحرقه فيقتل من قبل من أمره الله بالدفاع عن نفسه ......نرفعه على الأعناق ونتغنى بالشهيد , لا يمكن إعتبار كل قادم شهيد , يجب أن نتعرف على دوافع القادم إن كانت شريفة أم خبيثة قبل إطلاق الشهادة عليه , الدم ومشكلة الدم ومأساة الدم إنها كلمة حق يراد بها باطل , لدرجة أن قاتل إسرائيلي معروف والذي يتكلم في شريط مازن ابو فاشا , يأتي إلينا ويبكي على الدم السوري وهو الذي إرتوى بدم الشباب الفلسطيني واللبناني والسوري , لذلك مسألة الدم يجب النظر إليها من باب الشهادة والنصر وليس من باب افتعال الجريمة والبكاء على المقتول لقتل بريئ آخر قد يكون ضابط أو عسكري أو مسئول هو في الحقيقة أشرف منهم عند الله والناس

ابو برزان القيسي
03-10-2012, 05:28 PM
http://www.iraqup.com/up/20120212/an0hI-W65Q_86122607.gif (http://www.iraqup.com/)

الشاعر لطفي الياسيني
03-11-2012, 01:53 AM
اقف اجلالا لعبق حروفك وابحارك في مكنونات
الذات الانسانية فاجدني عاجزا عن الرد حيث
تسمرت الحروف على الشفاه جزيل شكري وتقديري
لما سطرت يداك المباركتان من حروف ذهبية
دمت بخير
الحاج لطفي الياسيني

</b></i>

اسماعيل الناطور
03-11-2012, 08:37 AM
لننظر للبدايات كيف بدأت الثورة بأطفال يرسمون على الحائط
تم إعتقالهم و سجنهم و تعذيبهم و قتل البعض منهم .

هل كان هؤلاء الأطفال يخططون لإسقاط النظام بالقوة
و هل من خرجوا في الأيام الأولى كانوا يحملون البنادق

من بدأ بالقتل هو النظام لأنه يشك في كل من يخالفه
و يصفه بالمتآمر و المندس و ال ..

إنظر من بدأ بالقتل .. و بالطبع الدم يولد الدم
بداية موفقة جدا لحوار هادئ جدا
من بدأ بالقتل ؟
وهنا أتمنى عليك تذكير القارئ بتلك المعلومة ومصدرها والتي تقول أن البداية كانت أطفال يرسمون على الحائط فتم تعذيبهم وقتل بعضهم
أريد توثيق هذه المعلومة ...فهل تقوم بتأكيدها للقارئ كما أنت متأكد منها ؟
على العموم لا تنسى أن هناك موضوع بدأته قبل أن يبدأ الحدث وإستمر للآن ( سوريا وثورة الجماهير ) وأعتقد أن المناقشات فيه كانت تتابع ما يجري
وأعتقد أن هناك مشاركة لي كانت تقول أقترح على بشار أن يستدعي رجال الجيش لأن رجال الأمن لا يستطيعون السيطرة على الموقف بعد القتل المستمر الذي كانوا يتعرضون له يوميا
وأعتقد أن بعد هذه المشاركة بيوم أو إثنيين تم إعلان دخول الجيش السوري لمدينة درعا ...أقصد من هذا ..أن المراقب العادي كان يستشعر أن المؤامرة قادمة فكيف بالمسئول
المهم أتمنى تأكيد معلومتك للقارئ ؟

اسماعيل الناطور
03-11-2012, 10:53 PM
اليوم
جمعة إسترداد الكرامة المصرية
اليوم
جمعة طرد السفيرة الأمريكية من القاهرة
اليوم دعوة شرفاء
فهل يستجيب شعب مصر

الأمثال الشعبية حكمة الشعوب وعبقريتها ( أسمع كلامك أصدقك أشوف عمايلك أستعجب ) مثل شعبي مصري في منتهى الحكمة وينطبق على عضو مجلس الشعب المصري الذي صرخ اليوم إمام الكاميرات وموجها حديثة للوزارة المصرية ( فيديو عضو سلفى يقول داخل المجلس لما انتوا مش اد ماما امريكا عاملين نفسكوا رجاله ليه ) , رغم أن لا أحد من أهل السلف ولا الترف السياسي شارك في مظاهرات يوم الكرامة يوم طرد السفيرة الأمريكية التي إغتصبت كرامة مصر عدة مرات أولها توجيه رسائل خاصة لوزير العدل وآخرها حماية العملاء في مبنى السفارة , مثل هؤلاء النواب ليسوا نواب شعب بل نوائب إبتلى الله بهم أعصاب البشر , للأسف مصر تحتاج لمن يرد لها الإعتبار ولكنها تنتظر الزعيم القادم ...فهل يجود به الزمان ؟
فهل يجود به الزمان والناخب لا زال لا يقدر قيمة صوته الإنتخابي ؟
فهل يجود به الزمان والمتقدم للإنتخاب يضع جهده وفكره في خدمة من يقدم له المال ؟
فهل يجود به الزمان وهناك من يرسم الخطط لإنهاك الناخب المصري بهذا العدد الضخم من المرشحين الهزليين لمنصب القائد ؟

اسماعيل الناطور
03-11-2012, 10:53 PM
اليوم
جمعة إسترداد الكرامة المصرية
اليوم
جمعة طرد السفيرة الأمريكية من القاهرة
اليوم دعوة شرفاء
فهل يستجيب شعب مصر

الأمثال الشعبية حكمة الشعوب وعبقريتها ( أسمع كلامك أصدقك أشوف عمايلك أستعجب ) مثل شعبي مصري في منتهى الحكمة وينطبق على عضو مجلس الشعب المصري الذي صرخ اليوم إمام الكاميرات وموجها حديثة للوزارة المصرية ( فيديو عضو سلفى يقول داخل المجلس لما انتوا مش اد ماما امريكا عاملين نفسكوا رجاله ليه ) , رغم أن لا أحد من أهل السلف ولا الترف السياسي شارك في مظاهرات يوم الكرامة يوم طرد السفيرة الأمريكية التي إغتصبت كرامة مصر عدة مرات أولها توجيه رسائل خاصة لوزير العدل وآخرها حماية العملاء في مبنى السفارة , مثل هؤلاء النواب ليسوا نواب شعب بل نوائب إبتلى الله بهم أعصاب البشر , للأسف مصر تحتاج لمن يرد لها الإعتبار ولكنها تنتظر الزعيم القادم ...فهل يجود به الزمان ؟
فهل يجود به الزمان والناخب لا زال لا يقدر قيمة صوته الإنتخابي ؟
فهل يجود به الزمان والمتقدم للإنتخاب يضع جهده وفكره في خدمة من يقدم له المال ؟
فهل يجود به الزمان وهناك من يرسم الخطط لإنهاك الناخب المصري بهذا العدد الضخم من المرشحين الهزليين لمنصب القائد ؟

admin
03-11-2012, 11:44 PM
اتفاق العسكر والإخوان على مرشح الرئاسة لمصرالعروبة
يدوس على كل التضحيات التي قدمها الشعب المصري الأبي
وتآمر واضح على دماء الشرفاء التي اريقت بميادين التحرير

تحيا مصر

اسماعيل الناطور
03-12-2012, 12:18 AM
1. عمرو موسى، أمين عام جامعة الدول العربية السابق.
2. - الدكتور عبد المنعم أبو الفتوح – طبيب وعضو سابق بجماعة الإخوان المسلمين
3. - حازم صلاح أبو إسماعيل – رجل قانون وداعية إسلامي
4. - الفريق أحمد شفيق، رئيس الوزراء السابق.
5. - الإعلامية بثينة كامل
6. - حمدين صباحي – مؤسس حزب الكرامة الناصري (تحت التأسيس) ومؤسس صحيفة الكرامة
7. - منصور حسن، وزير الإعلام الأسبق
8. -الدكتور محمد سليم العوا – محامي ومفكر إسلامي
9. - ممدوح قطب، المدير السابق بالمخابرات العامة
10. - النائب أبو العز الحريري – مرشح حزب التحالف الشعبي الإشتراكي
11. - الفريق حسام خير الله – وكيل جهاز المخابرات العامة المصرية الأسبق
12. - المستشار هشام البسطويسي – قاضي ونائب رئيس محكمة النقض السابق
13. - السفير عبد الله الأشعل
14. - الدكتور محمد النشائي
15. - خالد علي – محامي حقوقي
16. - منى البرنس – كاتبة روائية
17. - المستشار مرتضى منصور – محامي ومستشار سابق بالقضاء المصري
18. - الدكتور باسم خفاجة – خبير التنمية الإدارية والتعليم
19. - الدكتور حسن نافعة – استاذ العلوم السياسية بجامعة القاهرة
20. - ا محمد حسني مبارك – إبن عم المخلوع/المخلوع محمد حسني مبارك
21. - موسى مصطفى موسى- رئيس حزب الغد
22. - حسام شلتوت – مرشح حزب “التكافل” لرئاسة الجمهورية
23. - اللواء أركان حرب محمد على بلال – قائد القوات المصرية فى حرب تحرير الكويت
24. - المستشار رأفت عبد الرحمن محمد اللمعي – مستشار بدرجة نائب رئيس هيئة قضايا الدولة
25. - صفوت العربى – شقيق جمال العربى وزير التربية والتعليم
26. - إبراهيم الغريب ، مستشار التنمية الإقتصادية
27. - مجدي أحمد حسين – الأمين العام لحزب العمل المجمد نشاطه
28. - حيدر البغدادى – عضو الحزب الوطنى المنحل
29. - خالد محمد عيد، عضو سابق بالجماعة الإسلامية
30. - محمد العمدة – النائب المستقل في مجلس الشعب عن محافظة أسوان
31. - محمود حسام – رئيس حزب البداية
32. - محمد فوزي – المحامي
33. - عادل فخرى دانيال – وكيل مؤسسي حزب الاستقامة
34. - المهندس يحيى حسين عبد الهادى
35. - سمير محمود عثمان – المحامي بالاستئناف العالي ومجلس الدولة
36. - المستشار عبد الراضي أحمد أبو ليلة
37. - محمود شريف – وزير الإدارة المحلية الأسبق
38. - د.عبد العظيم نجم – الأستاذ بكلية هندسة جامعة الزقازيق
39. - المطرب نادر أبو الليف
40. - الرائد ياسر أبو المجد، الضابط بمطافئ الجيزة
41. - أحمد الجارحي – حكم كرة القدم السابق
42. - ناصر أحمد السعيد بدر – المحامي
43. - أحمد سرحان – الضابط السابق بمباحث الجيزة
44. - الدكتور محمد مقبل – صاحب قناة البدر الفضائية
45. - مراد عبد الفتاح حسين – ميكانيكي – وشهرته “صاصا الميكانيكى” بدمنهور.
46. - محمد عبد الخالق البديوي – مدير مستشفى سلمى للتجميل
47. - المستشار محمد عبد الحكيم حبيب – نائب رئيس محكمة الاستئناف العالي بطنطا
48. - السيد حسن رجائى حسن – الناشط السيناوى
49. - حمدي مصيلحي شلبي – رجل قانون من المنوفية
50. - المهندس ياسر قورة وقد ترشح لمجلس الشورى أيضا
51. - أبو بكر صدقى شحات محمود – الموظف بالأزهر الشريف بمحافظة قنا
52. - فرغل أبو ضيف عطية – من سوهاج، ويعمل في المقاولات
53. - محسن محمد فؤاد فايد – مهندس
54. - محمد محمود رمضان
55. - د/ حامد الحامد – باحث الفضاء




ربما تحتاج يا أ اسماعيل
متصفح اخر غير هذا لكتابة كل أسماء من سيترشحون فاليوم فقط
تم سحب اكثر من 150 استمارة ترشيح لرئاسة الجمهورية

و لست أعلم ما المقصود بهذا
هل هناك قوى تدف بهم لتفتييت الأصوات أم لتجميعها و من ثم التنازل لمرشح معين
ما تفسيركم بوصفكم محلل إجتماعي لهذه الظاهرة ؟

حقيقة لم أكن اتخيل هذا العدد فلقد تخيلت ان يصل
الى 50 او 60 على أقصى تقدير



طبعا أنت تعرف أن من يقود حملة بعض المرشحين هم مجموعة من خبراء علم النفس وهذا العدد الضخم من المرشحين يستهدف
1- تخفيض حماس الناخبين للحملة الإنتخابية بإرسال رسالة غير مباشرة لوعي الناخب بعدم جدية المرشحين من فنان إلى فنانة إلى ميكانيكي إلى نكرة الكل يتقدم ويعلن نيته لكسب كرسي القائد
2-منع نجاح أي مرشح من الجولة الأولى وذلك بتفتيت الأصوات كما قلت ولمزيد من إمتصاص حماس الناخب والذي قد ينتخب في المرة الأولى ولا يعود للإنتخابات في جولة الإعادة مما يتيح لمجموعات الأصوات المبرمجة من النجاح في إعلاء نسبة من يريدون
3- منع نجاح أي مرشح من الجولة الأولى يتيح لعناصر المراقبة من دراسة الناخب المصري على الطبيعة للسيطرة على الثغرات في جولة الإعادة
4- منع نجاح أي مرشح من الجولة الأولى يتيح التخلص من الغير مرغوب فيهم في الجولة الثانية بعدة طرق بينها البيع والشراء والترغيب والتهديد وكشف الملفات الشخصية وقتل الشخصية ن إستلزم الأمر ذلك
5-كثرة المرشحين تعمل على إرباك أجهزة الرقابة وأجهزة الأمن والرقابة المالية
6- كثرة المرشحين تعمل على إرباك الناخب الجاد وربما الوصول به إلى صرف النظر عن المتابعة الجادة مما يجعله ضحية للشائعات وليس للمعلومات الموثقة
وهناك الكثير يمكن قوله في هذا العدد الضخم من مرشحي الرئاسة مع أن الرئيس القادم لن يكون إلا واحد من خمسة سنأتي على ذكرهم بعد قفل باب الترشيح

اسماعيل الناطور
03-12-2012, 10:45 AM
الجزيرة (حمار) مباشر

http://i.aksalser.com/u101106/98823071.jpg
موجز النشرة







http://www.almolltaqa.com/images/news/1644043179ser1677.jpg


رسالة أدمن أول وأشهر الصفحات التونسية التى دعت للثورة فى تونس والتي قال فيها "أريد أن أصارحكم بما في قلبي والله شاهد على ما أقول ... لا تسبوني ولا تشتموني لأن كلامي هذا مر و لن يعجب معظمكم ولكنني قررت أن أصارحكم به لانه الحقيقة التي توصلت إليها بعد أن تفقهت قليلا في ديني و بعد أن رأيت بعيني ما سوف تسمعونه الآن مني ".
وقال : " لو كنت أعلم بان كل هذه الفتن ستحل بنا ليلا نهارا بعد الثورة لما دعوت الناس للخروج ضد بن علي و لما جعلت هذه الصفحة مساهمة بقوة في الثورة التونسية ... الآن تيقنت ان هذا الشعب مع كل الشعوب العربية لا يستحقون الحرية ولا ينفع معهم إلا العصا لأن نفوسهم مريضة و قبل تغيير حكامهم كان الاولى بهم أن يغيروا أنفسهم ".
وأضاف في رسالته " كذلك لا أظن ان بن علي او مبارك او بشار الاسد و القذافي و صالح أشر من الحجاج ابن يوسف فما فعله الحجاج في عهده لا يجرؤ اللسان على ذكره ومع ذلك لم يخرج عليه اهل السنة والجماعة و صبروا على أذاه و ظلمه و بطشه".
وتابع :"لقد ندمت لقد ندمت لقد ندمت على ما فعلته عن جهل و ان حزني كبير و همي عظيم على هذا الحال الذي وصلنا اليه اليوم ... انظروا كيف جنت ثورتنا على بقية الدول العربية انظروا كم من مسلم ومسلمة قتلوا في بلادنا تونس اولا ثم مصر و ليبيا و اليمن و سوريا و غيرها كما اذكركم جميعا بأن الجزائر قتل فيها طوال عشرية سوداء من فترة التسعينيات اكثر من 250 الف مسلم ومسلمة جراء فتنة كبيرة و لهذا لم تقم اليوم ثورة في الجزائر بالرغم من فساد نظام الجنرالات الذي يحكم هناك فالجزائريون ذاقوا ذرعا من كوارث وخراب الثورات حين انعدم أمنهم و ازهقت أرواحهم. فحياتهم و أمنهم اليوم أغلى عندهم من الثورة التي قسمتهم الى مسلمين و كفار و سفكت دماءهم بغير حق".

اسماعيل الناطور
03-12-2012, 10:50 AM
اتفاق العسكر والإخوان على مرشح الرئاسة لمصرالعروبة
يدوس على كل التضحيات التي قدمها الشعب المصري الأبي
وتآمر واضح على دماء الشرفاء التي اريقت بميادين التحرير

تحيا مصر
أحذروا السبعة الذين إجتمعوا تحت رئاسة وائل غنيم
فهم نسخة جديدة من مبارك تحت أقدام الأمريكان
البرادعي-عمرو موسى-الغزالي حرب-ابو الفتوح -حازم ابو اسماعيل -حمدين صباحي -والبسطويسي
وإلى لقاء مع موضوع خاص عن الرئاسة عندما تظهر الأسماء التي قدمت نفسها للترشيح فعلا
من الواضح أن أقوى حملة ( ماديا ) حتى هذه اللحظة هي حملة حازم ابو اسماعيل
-مقابلات يومية على عدة فضائيات
-مقالات صحفية على عدة مجلات وجرائد وملتقيات
-حتى التوكيلات الشعبية هناك من يصورها وينشرها يوميا
السؤال ..ما تكلفة هذه الحملة بالضبط ومصادر التمويل ؟
نسأل فقط للبحث عن المعلومة
بينما حمدين صباحي يقول أن حملته من فقراء الشعب المصري تحت شعار
إدفع جنيها تصبح رئيسا !!!!!!!

اسماعيل الناطور
03-12-2012, 11:07 PM
العرب إلى الهاوية




ركاد حسن خليل







يقال المكتوب يُقرأ من عنوانه..





في مراجعة شاملة لمسيرة الأحداث التي تجري في منطقتنا العربية منذ انطلاق الحراك الشعبي التونسي الذي أدى لسقوط بن علي.. ومن بعده مبارك في مصر.. والقذافي في ليبيا.. وعلي عبد الله صالح في اليمن.. وصولاً إلى المجازر البشعة التي تُرتكب في سوريا على يد النّظام و أتباع النظام.. أو من الجماعات المسلحة بكافة فئاتها وانتماءتها وولاءاتها.. الذي سيؤدّي إلى سقوط بشار الأسد.. إن عاجلاً أو آجلاً.. لا لضعف بالنظام وما يرتكبه بحق الشعب السوري.. ولا لقوّة تمتلكها الجماعات المسلحة- كل جماعةٍ وما تسعى إليه من أهداف- وجيش سوريا الحر.. إنّما قوة الأجندات الموضوعة للمنطقة التي أدت بالحركات الجماهيرية البريئة والمحقّة أن تصل للطريق الذي لا خيار لها فيه سوى اللجوء للعنف والسلاح.. في مواجهة الرئيس بشار كرئيسٍ للنظام الذي لم ينته بعد.. وأرعبه بكل تأكيد المصير الذي وصل إليه كل من بن علي ومبارك والقذافي وعلي عبدالله صالح.. ولن يقبل بأيِّ حالٍ من الأحوال أن يكون هذا مصيره.. وهو المؤمن أن بيده أوراقًا كثيرة لا يزال ممسكًا بها تمكّنه من المحافظة على كرسي فاعل ومؤثر في اللعبة .. ويغيب عن تفكيره أن هذه اللعبة شارفت على نهايتها وأن المنطقة أصبحت على أبواب مرحلةٍ جديدة





تُرسم فيها خارطتها السياسية والجغرافية والديمغرافية من جديد.. وأن ثورات الشعوب العربية على عدالتها.. وحقّها في التّغيير والخلاص من الاستبداد.. كانت البوابة الأسهل للقوى العظمى وأمريكا للولوج منها نحو تغيير ملامح المنطقة.. واستطاع هؤلاء بولوجها أن يكونوا أقرب لتحقيق أهدافهم بما يحفظ لهم سيادتهم ومصالحهم ويقوّي شوكة الكيان الصهيوني الغاصب المزروع مكان القلب في الجسد العربي .





ممّا يدل على أن هذه الثورات العربية وصلت إلى مأزق كبير وخطير لأسباب عديدة أهمّها:





1- افتقدت هذه الثورات جميعها خاصّيّة التنظيم المسبق.. والكوادر الوطنية المخلصة والمعروفة القادرة على تأطير حركتها ومسيرتها وأهدافها.. والبرنامج السياسي الواضح والمحدد.. واقتصر كل شيءٍ على الارتجال والعشوائية وعلى شعارٍ واحد مرفوع وهو إسقاط النظام.. وبقيت حركة الجماهير بيد شباب تختلف مشاربهم وانتماءاتهم وقدراتهم على التّأطير والقيادة .. فخرجوا مبكّرًا من المسيرة بعد الانتخابات التي جرت في تونس ومصر على سبيل المثال.

2- همجيّة الأنظمة وتسلّطها وصلفها وجبروتها في التعامل مع الشعوب.. وانتهاجها عصًا غليظة للترهيب والتنكيل وصلت إلى حد السّحل والذبح والاغتصاب للحرائر . مما جعل البعض أن لا يكون أمامه سوى حمل السلاح للدفاع عن النفس والعرض.. و فرصة لآخرين ممن تسوّل لهم أنفسهم وجب اغتنامها لحمل السلاح واستعماله في غير ما مصلحةٍ وهدف.
3- استماتة القوى العظمى وأمريكا في الدفاع عن مصالحها وتسيّدها في المنطقة العربية.. جعلت منها بعد أن رأت أن صلاحيّة الحكّام في استعبادهم لشعوبهم قد انتهت.. وأن ثورة هذه الشعوب لا بد أن تُطيح بهؤلاء الحكام .. سارعت هذه القوى بخطوة إلى الأمام للملمة ما يمكن أن تسفر عنه هذه الثورات بخطوة متقدّمة لتعلن عن مناصرتها لحركات الجماهير ومؤيدة لمطلبهم بالحرّية.. واستطاعت بخطوتها هذه أن تُدخل المسيرة الثورية العربية برمّتها إلى طريق واحد لا ثاني له.. وترقبها بأدواتها بحيث لا تصل هذه الحركات الثورية إلاّ إلى المكان الذي تريده هذه القوى ويكفل لها مصالحها وبقاء سطوتها ونفوذها.. وهذه نتيجة أصبحت تكاد حتميّة.. وهذا ما يبيّنه الواقع على الأرض حتّى الآن.
4- الدور الذي تقوم به بعض الأنظمة العربية خصوصًا الخليجية منها بما تمتلكه من وسائل إعلام موجّهة وتضرب على نغم أن لا إمكانية للشعوب للخلاص إلا بركونها للغرب وقواه العظمى وأدواتها في المنطقة.. بحيث تقتل كل الخيارات أمام الجماهير العربية لكي لا يتبقى إلا هذا الخيار لتجري على أساسه المقايضات حفاظًا على المصالح.
للأسف أن كل ما تحقق إلى الآن هو لغير صالح الشعوب العربية وخارج عن إرادتها.. وبقيت القوى العظمى بزعامة أمريكا وربيبتها إسرائيل.. الكيان الجرثومة في المنطقة العربية.. الأقوى .. ولا تزال لهم الكلمة الأولى والأخيرة .. والذراع الطولى لفعل أي شيء دون حسابٍ أو رقيب.
وما الاعتداءات التي تجري اليوم في غزة وسقط خلالها العشرات بين شهيدٍ وجريح إلا شاهدًا على هذه الحقيقة.. وبقيت مصر بحكومتها الجديدة وبعد رحيل مبارك,. تمثّل نفس الدور الذي كانت تمثّله حكومة مبارك حتّى اليوم الأخير من عمرها.. ووقفت حكومة الجنزوري تطالب الفلسطينين بالتزام التهدئة وعدم الرد على المجازر التي ارتكبتها إسرائيل.. بدل أن تختلف لهجتها على الأقل لتصبح رادعة وصارمة أمام الصلف الذي تمثّله أمريكا ومن خلفها إسرائيل.
لا يبدو في الأفق العربي اليوم بهذه الصورة إلا غيومًا ملبّدة لا نلمح خلفها شمسًا أبدًا.
الفلسطينييون (القيادة الفلسطينية بكافة فصائلها) أُدخلوا إلى اللعبة قبل أي نظام عربي للأسف.. وغدت البندقية والمقاومة المسلحة عند جميع فصائل المقاومة عبارة عن ردّات فعل تنتهي بانخفاض تأثير هذا الفعل أو الحدث على المشهد العام.. ولم تعد هذه المقاومة كفاحًا مسلحًا مستمرًا حتى يزول الاحتلال.. ويحقق الشعب الفلسطيني أمانيه في تقرير مصيره وتحرير أرضه ومقدساته وإقامة دولته المستقلة على كامل ترابه الوطني.
والعرب كل العرب أصبحنا أضعف من أي وقتٍ مضى.. شعوبنا تتجه نحو حربٍ أهليّة بعيدة المدى.. ولم يبق إلا الشرارة التي تُشعلها.. وبلادنا إلى انقسامٍ لا يمكن أن يُرأب صدعها مهما أخلصنا النوايا إن كان في الخبايا ما يشيبها ويعكّر نقاءها.. ولطالما كنّا نحسب بغير مقاييس. لذلك كلّه نحن العرب نتّجه فعلاً إلى الهاوية


أخي ركاد
يجب أن نعترف مهما كانت قسوة الإعتراف إنها كانت ثورة حمير وحمير لم نستخدمها للشتم بل إستخدمناها لإبراز النتيجة والتي أوضحتها في تقديمك للموضوع , لم نكن يوما مع الحكام وكنا ننتظر الثورة وندعوا لها , ولا يمكن أن يزايد علينا أحدا بذلك , فكل مواضيعنا ومشاركاتنا لا زالت موجودة قبل هذا الربيع الدموي وبعده , كنا ننتظر ثورة تأتي بالصلاح والكرامة والنصر , فجاءت لنا ثورة أبطالها وتمويلها ونتائجها ضد الصلاح والكرامة والنصر , ولكن لا زال هناك وقتا لأن يصحو البعض وخاصة في مصر وسوريا لإنهم القيادة شاء من شاء و أبى من أبى , لا زال هناك أمل بشرط أن يبقى الجيش العربي المصري متماسك والجيش العربي السوري متماسك أما غير ذلك فإنها ثورة حمير ونتائجها لن تكون إلا لصالح الماسون وبني صهيون مهما حاولوا تغيير اليافطات وتغييب وعي الشعوب وقتل الأحرار تحت وابل من الكذب الممنهج

اسماعيل الناطور
03-12-2012, 11:55 PM
في مصر لم تكن ثورة حمير مطلقا ... لكن ثورة شعب بها بعض الحمير !
و لقد تفضلتم يا أ اسماعيل بكشف اللثام عنهم و احييكم أيما تحية لذلك !

الحمد لله الجيش المصري مازال متماسكا و متيقظ جدا لما يحدث
و لن تجرؤ بإذن الله أي قوة على إستفزازه أو أي أغبياء على استرحامه
و إثارته للدخول في معركة المقصود منها الدفع به لمواجهة تكلفه الكثير
و تثنيه عن مهمته الحالية للمرور من الفترة الإنتقالية الحرجة !

الجيش السوري بلع بشار الطعم بغباؤه و دفع بالجيش للهاوية !
و تركه يقطع في أوصال الشعب و بلداته بحجة مواجهة مجموعات
إرهابية نزلت من المريخ ... في مؤامرة كونية لإنتزاع كرسي أبوه !


ليس مطلوبا من الجيش المصري إلا المحافظة على أمن مصر والمحافظة عليها من التقسيم ومن يطالب من مصر الآن شيئا فهو إما جاهل أو متآمر

اسماعيل الناطور
03-13-2012, 12:40 AM
الجيش السوري بلع بشار الطعم بغباؤه و دفع بالجيش للهاوية !
و تركه يقطع في أوصال الشعب و بلداته بحجة مواجهة مجموعات
إرهابية نزلت من المريخ ... في مؤامرة كونية لإنتزاع كرسي أبوه !

الأخ محمد
بشار لم يبلع الطعم , بشار في الحقيقة لم يبلع طعم ثورة الحمير , ولم يترك فرصة لحمير المجالس تقسيم الجيش بين نظامي وخر بالخاء وليس بالحاء , الأيام بيننا والحقائق تتوالى وغدا لناظره قريب , هل هناك أسوأ من الكذاب , مجزرة كرم الزيتون قام بها وحوش إلحقوا أنفسهم بإسم الثوار وهم من الثورة براء والأسوأ من ذلك يكذبون ويلحقونها بالجيش رغم أن الحقيقة أعلنها أصحابها وأهاليها ولكن الله لهم بالمرصاد والجرائم والكذب لن يستمر طويلا , أخي محمد أرجوك أن تتحقق من كل ما تقرأه أو تسمعه , فحمير مصر هناك مثلهم في سوريا , ولو أن ما تم الاعلان عنهم في مصر هم لا زالوا برئيين من الدم ولا زال البحث جاريا عن الطرف الثالث الدموي والذي ظهر جزءا منه في أحداث بورسعيد ولكن لن نتهم أحد إلا بعد صدور الأحكام والأسماء والتي سيقوم به القضاء المصري والذي يتعرض أيضا وبطرق مختلفة للهدم ولكن مصر آمنه وستبقى آمنه فهى أكبر من أن تحيط بها فئة قليلة من الحمير

اسماعيل الناطور
03-13-2012, 12:43 AM
ليس مطلوبا من الجيش المصري إلا المحافظة على أمن مصر والمحافظة عليها من التقسيم ومن يطالب من مصر الآن شيئا فهو إما جاهل أو متآمر

قطعت جهينة قول كل خطيب !
أو ( من الأخر ) كما يقولون !


```````````````````````````````

اسماعيل الناطور
03-13-2012, 01:43 AM
وصمة عار على جبين كل إمرأة مصرية ,,,,علياء المهدى العارية تمثل نساء مصر فى يوم المراة .
http://www.youtube.com/watch?v=iDM8LovpHJg

اسماعيل الناطور
03-15-2012, 03:24 AM
فلسطين
لا تهتم الا بالمناضلين
لا تسأل عن رواد المقاهي
فلسطين حين قررت ان تثور
ثارت وحدها
وسط هزيمة كل الجيوش
كانت نكسة حزيران1967
وحمل الفلسطيني السلاح
الموضوع هنا
حق يريد له بعض الذين تعودوا على النفاق الباطل
من قال ان الفلسطيني ينتظر المدد من الصعاليك
هذا هو المدى الذي ستصل اليه افعال المتثورين
فلسطين الى الجحيم
ولتكن اسرائيل سيدة العرب اجمعين
فحذار ان تقتربوا من المحرمات

اعترافات الارهابي نوار محيميد أحد مرتكبي مجزرة كرم الزيتون



http://www.youtube.com/watch?v=8oagnafliv8&feature=g- (http://www.youtube.com/watch?v=8oagnafliv8&feature=g-all-u&context=g2b23c0dfaaaaaaaabaa)
all-u&context=g2b23c0dfaaaaaaaabaa (http://www.youtube.com/watch?v=8oagnafliv8&feature=g-all-u&context=g2b23c0dfaaaaaaaabaa)



بالدليل القاطع ..هكذا تمت فبركة مجزرة كرم الزيتون (http://www.youtube.com/watch?v=lsnn5imidim)


[/url]

رابط الفيديو الأصلي لمن يريد التأكد

[url]http://www.youtube.com/watch?v=i65g-anwwnu (http://www.youtube.com/)


وأيضا سوريا لا تحتاج لبكاء المغفلين

اسماعيل الناطور
03-15-2012, 01:15 PM
http://i3.makcdn.com/userfiles/a/n/anaadam/images/77.gif

يظهر لا الجامعة نافعة
ولا الناتو معاه فلوس
ولا عندنا عقل يشفع
يا خسارة
باين راحت علينا
والله إنكشفت ياعبده
صحيح إنك حمار
الشعب السوري كله طلع بشار
الله يخرب بيتك ياقوقل ضحكت علينا
والله ورطتني هالجامعة الغبية
أنا كنت عايز قرار بدعوة الناتو
مش قرار يقول تعليق ...
وتعال يا عبده نتفاوض معاك
يا ترى من أرسله ليمثلني بعد أن رفض الشعب السوري كل من صدقني وإعتقد إني خرجت من فصيلة الحمير


آخر أخبار عبده الحمار
أصابه إكتئاب....... ,
وفشلت جهود الأطباء وعقول الأذيال والكتاب وتلميع الذئاب
وإنصرف الناس عنه إلى جمعة التقوى والصلاح بدلا من جمعات النصب والنصاب
وحتى سبت الحمير ما عاد له جذب أو إنتباه
فلقد فعلها بشار ........
وكان خميس كرامة الوطن كل الوطن
خميس أحدث الكآبة لعبدو الحمار

اسماعيل الناطور
03-16-2012, 05:21 PM
آخر أخبار عبده الحمار

أصابه إكتئاب....... ,
وفشلت جهود الأطباء وعقول الأذيال والكتاب وتلميع الذئاب
وإنصرف الناس عنه إلى جمعة التقوى والصلاح بدلا من جمعات النصب والنصاب
وحتى سبت الحمير ما عاد له جذب أو إنتباه
فلقد فعلها بشار ........
وكان خميس كرامة الوطن كل الوطن
خميس أحدث الكآبة لعبدو الحمار

فيما يخص المظاهرات المفتعلة في أكبر ساحات سورية اليوم ، فقد وردنا ، أخي إسماعيل ، معلومات موثوقة حول حجم التزييف الإعلامي الذي يمارسه "النظام الأسدي الكافر المجرم عديم الضمير وقاتل الأطفال وآكل لحوم البشر والقردة والمتفوق على الصهاينة وعبدة الأوثان في إجرامه


http://sana.sy/servers/gallery/201203/20120315-125322.jpg

http://sana.sy/servers/gallery/201203/20120315-125401.jpg

وتماشيا مع الجهود المبذولة "عالميا" للتخفيف من وطأة الصدمة النفسية التي يعاني منها "عبده" حاليا ، فقد أصدرت نقابة الرفق بعمال جر العربات بيانا نفت فيه صحة الأخبار التي "يروج" لها "أبواق النظام" الحاكم في سورية ، وقد أكد خبير عالمي ومعروف ( رفض الإفصاح عن أسمه ) في مجال التحقق من الصور أن المظاهرات التي تدعي وسائل الإعلام السورية أنها حدثت اليوم في ساحات سورية هي مجرد "كذب وتلفيق" واضح لا لبس فيه وقال أيضا في بيانه الطويل

كلنا يعلم ( مع أنه لم يشرح من هم "كلنا" ) أن هذه المظاهرات مفبركة ، والشمس لا يمكن تغطيتها بغربال ( مع أنه لم يشرح ما هي الشمس وما هو الغربال ) فالمظاهرات كما هو واضح في الصور التي نشرتها محطات الفبركة السورية غير واضحة ولا تنطلي حتى على الأطفال ( أفلام توم وجيري أكثر واقعية منها )

http://sana.sy/servers/gallery/201203/20120315-125343.jpg

كما أن النظام عندما يتشدق بوجود مليوني متظاهر في ساحة الأمويين فإنه قد أوقع نفسه في فخ حفره لنفسه بنفسه ، فأين باقي السكان من أهالي دمشق البالغين ستة أو سبعة ملايين ، أين هم ، أين الأطفال وأين الرضع وأين العجائز أين العسكريين وأين المغتربين ، لماذا لا نراهم في الصور ، أم أن آرائهم ليست ذات قيمة ، ما يريد هذا النظام قوله هو أن باقي سكان دمشق لا قيمة لهم ، فكيف لنا أن نثق في حاكم مجرم لا يحترم حتى آراء الأطفال والرضع ومشاعرهم ، كيف ؟

http://sana.sy/servers/gallery/201203/20120315-130842.jpg

لا يكتفي هذا النظام المجرم بتلفيق مشاهد المظاهرات بل ويكشف نفسه عندما يقوم بإستيراد المتظاهرين من الدول المارقة وإلا كيف نفسر الملامح الآسيوية للمتظاهرين وعيونهم التي تدل على أنهم من كوريا الشمالية والصين ، كما نلمح أيضا وجوها تدل ملامحها بشكل واضح لا لبس فيه ( حيث يمكن معرفة الحمض النووي للمتظاهر من الصورة ) على أصولهم الإيرانية التي تشي بالكثير الكثير عن قرب إنهيار النظام خلال ست ساعات وخمسة وعشرين دقيقة وثلاثين ثانية ، فهذا النظام يعالج سكرات الموت الأخيرة له كما هو واضح لكل ذي لب ( بما فيهم ثمار المانجو التي تتميز باللب الكبير والبطيخ الذي يتميز بكثرة اللب فيه )

http://sana.sy/servers/gallery/201203/20120315-125401.jpg

إنني أدين وبشدة وبأقسى العبارات الممكنة ، ما فعله أزلام النظام المجرم عندما حملوا تابوتا كتب عليه "الثورة السورية" وقاموا في مشهد يندى له جبين الإنسانية بتشييع الثورة إلى مثواها الأخير ملفوفة بعلم الإنتداب الفرنسي في حفرة كتب عليها "تل أبيب" ، فهذا استخفاف واضح بالعقول ، لأن الثورة ليست جثة يمكن حملها في المظاهرات ووضعها في توابيت ، فهذا السلوك اللا إنساني والمشين والذي يستهزء بطقسية الموت في كل أنحاء الأرض ( وبقية كواكب المجرة أيضا ) ولا يمكن فهم هذه الإستعانة بالإعلام الفلسطينية وأعلام حزب الله وحماس والصين وروسيا ، فهل هؤلاء لهم حق الإنتخاب في سورية وهل حرق علم الإنتداب الفرنسي والذي يرمز إلى الثورة إلا ذرا للرماد في العيون ( نتج عن حرق العلم دخان أصاب عيون المتظاهرين بالإدماع )

http://sana.sy/servers/gallery/201203/20120315-130946.jpg

وإذا أمعنا النظر جيدا في صور هذه المظاهرات وخاصة صور مدينة حلب ، فإننا ( أيضا لا يشرح لنا الخبير من هم "نا" ) سنكتشف كيف يقوم هذا النظام المجرم بإجبار الناس على النزول إلى ساحة الجابري هناك ، وسنجد كيف أن وراء كل متظاهر ثلاثة أو أربعة رجال أمن يحمل كل منهم سلاحه ملقما ويصوبه نحو رأس المتظاهر مجبرا إياه على الوقوف وسط الرياح الباردة والعاتية كي يخرج النظام الكافر هذا إلى الإعلام بأن له شعبية ما على الأرض

http://sana.sy/servers/gallery/201203/20120315-143852.jpg

ثم هل يعقل أن يتجمع هذا العدد الكبير من الناس البسطاء والسذج دون أن يتسبب البرد في مرضهم وإصابتهم بالزكام ، وبينما ملأ أنصار الثورة الساحة ذاتها بالمليارات ورفعوا أعلام الثورة ، فقد لجأ الإجرام الكافر إلى الفوتوشوب وقام بتزوير ألوان الأعلام الثورية ليضع مكانها ألوان أعلامه المختلقة زورا وبهتانا في ظاهرة تلتفت إلى جحوده لفرنسا وعلمها الحر ، كل هذا فعله النظام المجرم ليلبس علينا أمرنا ويقنعنا بأنه لا توجد ثورة للحق والعدل على أركانه البائدة

http://sana.sy/servers/gallery/201203/20120315-143802.jpg

أما مظاهرات طرطوس وما أدراك ما طرطوس ، فكل العالم يعلم ( قامت مراكز مختصة بإجراء بحث عالمي وتأكدت من أن كل البشر يعلمون ذلك ) أنهم وبسبب إدمانهم الشديد على شرب "المتة" قد حدث لهم أعراض ما يسمى في علم النفس "إدمان المشروبات النباتية غير الثورية" وما كان على النظام الكاذب والمفتري إلا أن نشر إشاعة بأن باخرة محملة بنبات "المتة" في طريقها للرسو قرب الميناء ، وأن من سيحمل الأعلام التابعة للشبيحة سيحصل مجانا على علبة من هذه النبتة ، وهكذا فقد انساق أبناء هذه المدينة الطيبة وراء الإشاعة وصدقوها ، وهكذا تمكنت آلة التزييف وكيّ الوعي الجمعي للأمة من تثبيت هذا المشهد البشع ( كي من دون بخار بسبب البرد )

http://sana.sy/servers/gallery/201203/20120315-144041.jpg

وإن نظرة بسيطة لهولاء المساكين والواقفين تحت الأمطار الشديدة في إنتظار "غودو" على متن الباخرة الأرجنتينية ليثير في النفس لواعج الحزن ويخرج زفرات الوجع القابع تحت الجذر التكعيبي في رأس الخيبة ، فماذا دار في خلد هذا النظام المجرم وهو يضحك على ذقون هؤلاء المواطنين البسطاء وهو يجبرهم على حمل الواقيات المطرية لإتقاء المطر الساقط على رؤوسهم وهم يتوقعون وصول "المتة" و"كافكا" معا

http://sana.sy/servers/gallery/201203/20120315-144112.jpg

أما الحسكة
http://sana.sy/servers/gallery/201203/20120315-120335.jpg

ودرعا
http://sana.sy/servers/gallery/201203/20120315-132127.jpg

والرقة
http://sana.sy/servers/gallery/201203/20120315-132612.jpg

ودير الزور
http://sana.sy/servers/gallery/201203/20120315-133301.jpg

والسويداء
http://sana.sy/servers/gallery/201203/20120315-133827.jpg

فالمشهد واضح ولا ضرورة لشرحه أكثر ، لأن جميع هؤلاء مرتزقة ( من خارج سورية ) وموظفين ( مرتشين برواتبهم ) وجبناء يخشون سطوة الأجهزة الأمنية والتي نعرفها جميعا ( أيضا جميعا هنا تدل على سان الأرض والمريخ معا ) وعملاء للصين وإيران وروسيا ، وجهلة ( واضح من نظرة عيونهم ) وإمعات ( يصدقون إعلامهم الكاذب )

إنا لله وإنا إليه راجعون ، وإذا استهلكت أخي إسماعيل خمس دقائق في قراءة هذا النص فاعلم أن الثورة ستنتصر بالتأكيد بعد ست ساعات وعشرين دقيقة وثلاثين ثانية فقط



وهل تتوقع غير الحمير يصدقون ما أفاد به هذا الخبير العالمي
فقد يكون هذا الخبير الذي قصدته الناطق الرسمي للمجلس الثوري الاسطبلي
أما بشأن الطراطسة فأنا أؤكد ما نقل عنهم فهم يبيعون العالم من أجل المتة
( طبعاً أنا أقول هذا الكلام جكارة بالشاعرة أحلام غانم التي غابت وباعتنا بعلبة متة )
الحقيقة أن الصور مفبركة بإتقان وهذه ميزة تمتع بها الجيش الالكتروني والشبكات المؤيدة للنظام
فقد صرح النظام أنه لن يقبل بالسيطرة على الأرض فقط بل سيسيطر على الأرض والفضاء معاً
(( ست ساعات وخمسة وعشرين دقيقة وثلاثين ثانية ))
الحمير الآن مختلفين على ساعة الصفر

حسبنا الله ونعم الوكيل
عمليا أخي فايز ، عندما تنشر الجزيرة أن الحساب البريدي للرئيس السوري قد تم اختراقه والحصول على آلاف الرسائل التي تصفها بأنها بالغة الخطورة وسرية ، وخاصةً أوامره المتعلقة بالتعامل مع الثورة والثوار ومراسلاته مع زوجته ، وتجد بعد ذلك من يقتنع بأن الرئيس السوري يقوم بالإتصال مع أركان الدولة وزوجته عبر البريد الإلكتروني ، فلا بد أن نسأل حقيقةً عن طبيعة المواد الغذائية التي يتناولها المشاهد المقتنع بذلك ، لأن فهم طبيعة هذه المواد قد يعطي فكرة عن سبب التلف الشديد لخلايا المنطق والمحاكمة العقلية لدى دماغ هذا المشاهد ، وهذا بدوره قد يساعد على القيام بحملة للتحذير من مخاطر تناول هذا النوع من الأغذية ، وبالتالي يمكن إنقاذ عدد كبير ولا بأس به من مشاهدي هذه القناة ومعتنقيها ومقتنعيها

يقول له الطبيب أكلت شيئا وداؤك في شرابك والطعام
وما في طبـه أن الغـزال أضـر بعقلـه رأي النعـام
تعود أن يصـدق ما يراه ولو عينـاه تسرح في منـام
فأُمسك لا يتاح له فيصحو ولا هو صـامت مثل النيام
فما تروي الجزيرة كان صدقا وأنْ في صدقها خير الأنام
فصدق يا غزال لما تـراه ولو ألقاك في الكرب العظـام
غدا لمـّا تضيع عن الطبيب فلن يجزيك ما لون الظـلام



وبعد أن إستمتعت بما قرأت لك من سخرية سياسية إعلامية من طراز جزيرة مباشر , بحثت عن طبيعة المواد الغذائية التي يتناولها المشاهد المقتنع بذلك الإختراق وما سبقه وما لحقه من أكاذيب ....فوجدته نباتا أخضر جميل الزهر إسمه البرسيم

ولكن أخي إسماعيل ، نفى ناطق رسمي من قناة الجزيرة وجود أي تأثيرات جانبية غير مرغوبة لهذا النبات الجميل على القدرة العقلية للمؤمنين بهذه القناة والمهتدين بهديها ، ولدى سؤاله حول الترابط بين الحملة الترويجية التي تقوم بها الجزيرة وسواها من القنوات العبرية لحث المشاهدين على تناول هذا النبات وبين الأخبار السياسية التي تقوم بنقلها ، فقد قال مؤكدا أنه لا توجد أية روابط بين الأمرين

وأوضح أن هذه القنوات تقوم بتلك الحملة مساهمة منها في نشر التوعية الصحية حول فوائد ومحاسن وخلال ومزايا وخصال ومنافع تناول هذا النبات "صحيا" ، وذلك ضمن الحدود العلمية المعروفة والمتعارف عليها تبعا لقرارات مجلس الأمن الصحي ورغبة المجتمع الدولي في نشر ثقافة الطب البديل عالميا واستجابة مع مطالب الشرعية النباتية الدولية

وعدد الناطق الرسمي فوائد هذا النبات وركز حول دوره في الحماية والوقاية من الزهايمر ( الخرف سواء السياسي أو غير السياسي ) ، وكذلك قدرته على الحد من أعراض فقد الذاكرة المبكر وفقر الدم التاريخي ، وقدرته الفائقة على تهدئة البارانويا ( شعور الإضطهاد والتآمر ) ، وكذلك تقليص الثغرة العصبية التي يعاني منها المصابون بالشيزفرينيا ( إنفصام الشخصية ) ، ومنع حمى البحر المتوسط من الوصول إلى فلسطين ، وتخفيف آثار وأعراض مرض نقص المناعة الأخلاقية المكتسب ، وأكد أن الأعراض الجانبية نادرة الحدوث وتقتصر فقط على إستطالة "بسيطة جدا جدا" في الأذنين ، قد تترافق مع خشونة "بسيطة جدا جدا" وغير ملحوظة في نوعية الصوت بالنسبة لمتعاطي هذا النبات الجميل لفترة تزيد عن السنة ، ,اكد وبشدة ( تسعة "ريختر" ) أنه ليس صحيحا أبدا ما يشاع في القنوات المعادية لقنوات "الإعتدال الربيعي" والتي تقول بأن صوت "المهتدي" يصبح من رتبة "أنكر الأصوات"

أحاول الآن الحصول على تصريح من مصدر مستقل لحملة "لا للبرسيم" ولكن لم يتم بعد التأكد منه ، وحرصا على الموثوقية والصدقية في نقل التصاريح ، سأحاول أن أتأكد من "شاهد عيان" قبل نقل التصريحات "المستقلة"
مازن ابو فاشا

اسماعيل الناطور
03-16-2012, 09:24 PM
الكتاتنى لوفد الكونجرس: نرفض التهديدات.. ومعايير واشنطن "مزدوجة"

الخميس، 15 مارس 2012 - 16:39

http://img.youm7.com/images/NewsPics/large/s3201215163455.jpg جانب من اللقاء
كتبت نور على - تصوير عمر أنس
http://www3.youm7.com/images/graphics/igoogle.gif (http://www.google.com/ig/adde?moduleurl=http://activedd.googlecode.com/svn/trunk/iGoogle/Gadgets/Youm7/Youm7.xml)
عقد الدكتور محمد سعد الكتاتنى، رئيس مجلس الشعب، لقاءً مع وفد الكونجرس الأمريكى، برئاسة نانسى بيلوسى، الرئيسة السابقة لمجلس النواب الأمريكى، وزعيمة الأقلية بالكونجرس، و6 من أعضاء الكونجرس بمجلسيه النواب والشيوخ.

يأتى اللقاء بعد توتر العلاقات بين القاهرة وواشنطن، على خلفية ملف تمويل المنظمات، كما شهد مجلس الشعب جدلاً واسعاً وانتقادات لاذعة للحكومة، بعد سفر المتهمين الأجانب فى قضية التمويل.

وطالب الدكتور سعد الكتاتنى، رئيس مجلس الشعب، كافة قوى المجتمع الدولى الاحتكام للقانون والشرعية الدولية، واحترام سيادة الدول، ورفض كافة أشكال التدخل وانتهاك سيادة الدول الأخرى. وقال إن البرلمان يرفض التدخلات والتهديدات التى يمارسها الكونجرس بشأن وقف المحاكمات وإسقاط التهم عن المتهمين، مطالباً الكونجرس والإدارة الأمريكية بالتوقف عن تطبيق المعايير المزدوجة فى التعامل مع قضايا تمس السيادة المصرية، وتساءل "الكتاتنى" عن المعايير المزدوجة التى تطبقها الإدارة الأمريكية بشأن موقفها من أعمال العنف فى فلسطين وتهويد القدس وهدم المسجد الأقصى.

وأكد رئيس مجلس الشعب على ضرورة التزام الكل بالقانون، مع رفض البرلمان للغة التهديدات والتدخل السافر فى شئون مصر الداخلية، من خلال التهديد باستخدام سلاح المعونة، وقال إذا كانت أمريكا وغيرها تظن أن مصر ستقبل هذه التهديدات فهى لم تقدر وتدرك التغيرات التى شهدتها البلاد فى أعقاب سقوط النظام السابق، وليعلم كل من تسول نفسه باختراق أمن مصر الوطنى أن الشعب المصرى لن يقبل بخرق سيادته، مهما كان الثمن فى المقابل.

http://www.youm7.com/images/issuehtm/images/youm/kongres1532012/1.jpg

http://www.youm7.com/images/issuehtm/images/youm/kongres1532012/2.jpg

http://www.youm7.com/images/issuehtm/images/youm/kongres1532012/3.jpg
نرفض ونشجب ونتوعد ...ثم نبتسم ونتعاون وننسى
وكل ثورة وأنتم بخير
راح مبارك وأتى مبارك
ويادار مبروك عليكي المستأجر الجديد

اسماعيل الناطور
03-16-2012, 09:26 PM
لكن إيه رأيك يا أ اسماعيل في القلم الذي يمسك به الكتاتني
أليس قلما مميزا و ممتازا للدور الذي سيلعبه و هو
( أكتب ما يملى عليك )
المشكلة هل هو يجيد الإملاء أم انه سيخطئ في كتابة ما سيملونه عليه
و تتحول إبتسامة الهانم التي بجواره الى ( تكشيرة ) مفتعلة باطنها سخرية
كبيرة انه مش بيعرف يكتب ... و لذا فمن البديهي انه لن يستطيع القراءة

و سيسقط في قراءة تاريخ امريكا جيدا و قراءة مواقفها المزدوجة
لكن هنا اراك ( شططت كثيرا ) ذكرت فقط أنه سيرفض و يتوعد و يشجب

و لم تذكر إنه ( سيدين ) إدانة قوية و بشدة !

و بكل الأحوال ... كلامه كلام طيب .. زي ما يكون بجد !



http://www.youtube.com/watch?v=sizh8ftchpm#!
تقول رئيسة مصر القادمة وطبعا بعد التقسيم إسوة بما حدث مع زميلها السنوسي حاكم أقليم برقة الليبي
محمد حسان وإلا الشيخ محمد حسان وإسمعوا التعبير أحسن
أما بالنسبة للرئيس
أحترم البرادعي وحازم ابو اسماعيل
والرئيس القادم هو عمرو موسى أو منصور حسن
وأما الزوج والحب ....أسيبكم احسن مع اسماء محفوظ مفجرة الثورة
سؤال لأخي محمد برجيس وطبعا للقارئ أيضا
أمريكا وفريدم هاوس تساعد ويقيم على أرضها العقيد عمر عفيفي
أمريكا وفريدم هاوس تحمي اسماء محفوظ وباقي الحمير
أمريكا وفريدم هاوس تحمي الجواسيس في مصر وتجبر مصر على تسفيرهم وتخفض من نسبة شرف القضاء
أمريكا والكونجرس تجتمع مع الأخوان والمجلس وتدعمهم سياسيا وماليا وعلنيا ويتبادلون الضحكات والشرف لا زال يدمي
أمريكا والرئيس أوباما يدعم المجلس العسكري تصريحات وعلنيا
هي أمريكا عايزة إيه بالضبط
وإلا إحنا في عيونها شوية عيال ترضي كل واحد فينا بشوية شوكلاتة مغلفة بفئة مالية دولارية تناسب الطالب والمطلوب
لا كرامة ولا موقف ....
إيه الذل ده ومين إللي فرضه على رقاب العباد
يعنى هو الموت بشرف مش برضه طريق للجنة وإلا أنا غلطان !!!!

اسماعيل الناطور
03-18-2012, 10:12 AM
16-إبريل-2012م
؟؟؟؟



http://www.almolltaqa.com/upload//uploads/images/domain-81160f4f92.jpg (http://www.almolltaqa.com/upload//uploads/images/domain-81160f4f92.jpg)

هذه آخر مشاركة من موضوع لي , وهو تاريخ وصورة , الصورة تحاول توضيح مستويات الحكومة العالمية والتي تقود العالم الآن , والتاريخ يحدد مؤتمر إقتصادي ضخم لا يتكلم عنه الكثير ولكنه مؤتمر للنخبة , النخبة التى تقود , النخبة التي لا تهتم بالظهور الإعلامي , النخبة التي تركت الكراسي المتحركة والتي يتساقط عليها البعض كالذباب , بل تقام الحروب والربيع والخريف والثورة والإنتفاضة والفساد والمحاكم والشريف والخبيث بصور إعلامية متجددة من عصر لعصر لإلهاء الشعوب , بينما النخبة تعد عليهم أنفاسهم وتسلبهم أموالهم وأوطانهم , ومن ترضى عنه تحميه , ومن لا ترضى عنه تعقد له المحاكم المحلية والدولية بل قد تفجره دون سبب , المهم أن يبقى المال وكل المال في يد النخبة , والشعوب دون إستثناء قطيع من العبيد الأوغاد , لا حرمة لهم في مالهم أو أوطانهم , إنها لعبة بين الخير والشر , فيها الخير غافل والشر متيقظ ويخطط ولا يترك نفسه للصدفه , لإنه يعلم أن وقوعه سيكون إنتهاءه , كان السبب في إهتمامي بعلم النفس وهو إطلاعي على جملة وردت في كتاب بروتوكولات صهيون , الجملة كانت في البروتوكول الأول ((( ولقد أخفينا علم النفس عن العالم )) هذه الجملة للأسف لم تعد موجودة في أي كتاب منشور , بل أن كل ما هو منشور عن البروتوكولات يحتاج إلى إعادة صياغة حيث تعمد أحدهم على تقديم جمل عن جمل أخرى وشطب فقرات معينة مما أدى إلى وجود نسخ فوضوية لا تغري القارئ بالمتابعة , ولكن تلك الجملة أدهشتني وحاولت أن أفهم لماذا هم أخفوا علم النفس عن العالم , فهمت أن علم النفس هو العلم الوحيد الذي يقود البشر وربما إلى حيث مقتله وهو سعيد بما يقوم به , إنظروا إلى هؤلاء الذين يفجرون أنفسهم بين آهاليهم من أطفال ونساء , وكيف تحول من مسلم إلى إرهابي قاتل وهو يظن إنه ذاهب إلى ربه شهيدا .
ولكن تلك النخبة ليس مجموعة من الأشخاص بل هم رأس متعدد له ملايين الأذرع تبدأ بالماسونية وتنتهي بجمعيات حقوق الحيوان

أبو صالح
03-21-2012, 08:40 AM
عندما نبحث عن جماعة الأخوان المسلمين تواجهنا صعوبة فهم
1- مصادر التمويل والغنى الفاحش للكثير منهم أفرادا وتنظيم
2-المساندة القوية والخفية لقدرتهم الرهيبة على الإنتشار وفي دول تختلف في المبادئ ومنطق الحكم
3- الدعم الواضح لهم من الغرب والشرق والذي لا يدعم الاسلام كدين ومنهج حياة
4- هم المستفيد الأول من الربيع العربي على الرغم إنهم ليسوا من قام بلحظة التفجير
5- هناك قادة عليهم الف علامة إستفهام مثل أردوغان ولا نريد أن نعود للماضي ونذكر شخصيات تاريخية


كل عام وأنت غبي بقلم/اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=12066 (http://wata1.com/vb/showthread.php?t=12066)
ثورة الحمير بقلم/ اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=9044

ما أروع حكمة العرب حين قالت أنَّ كل إناء بما فيه ينضح، أظن المداخلة المقتبسة بالإضافة إلى العناوين توضح بشكل عملي عندما تكون هناك أي فسحة للحرية فيستغلها مثقف دولة الفلسفة لتشويه كل ما هو جميل بنا
يا اسماعيل الناطور الأبيض عندما تقول عنه أسود وتصدر فتواك على اللون الأسود هذا لن يجعل اللون الأبيض أصبح أسودا ولكن هذا يُبين غباءك/حميرتك أنت بالإضافة إلى غباء/حميرة من لم ينبته إلى ما تقوم به من تزييف الوعي عن عمد وقصد والمأساة ليست تكمن هنا فحسب من وجهة نظري،
المأساة الحقيقية أن ما تقوم به هو فقط من أجل نفخ الماسونية والصهيونية وبقية أذنابها في الغرب وعمل منهم اساطير يتعدون في امكانياتهم الله سبحانه وتعالى وهنا مصيبتك أنت وأمثالك يا اسماعيل الناطور المؤمنين بنظرية المؤامرة بدون حتى أي دليل منطقي أو موضوعي ناهيك أن يكون له أي علاقة بالعلم والذين ينطبق عليهم قول الله سبحانه وتعالى في سورة الكهف
(قل هل ننبئكم بالأخسرين أعمالا (http://www.islamweb.net/newlibrary/display_book.php?flag=1&bk_no=51&ID=1034#docu)( 103 ) الذين ضل سعيهم في الحياة الدنيا وهم يحسبون أنهم يحسنون صنعا (http://www.islamweb.net/newlibrary/display_book.php?flag=1&bk_no=51&ID=1034#docu)( 104 ) أولئك الذين كفروا بآيات ربهم ولقائه فحبطت أعمالهم فلا نقيم لهم يوم القيامة وزنا (http://www.islamweb.net/newlibrary/display_book.php?flag=1&bk_no=51&ID=1034#docu)( 105 ) )
ولذلك أنا نشرت ما نشرته تحت العنوان والرابط التالي
مُثَّقَّف دولة الفَلسَفَة بقيادة جمال عبدالناصر وبقية الحكام في دولنا من خان فلسطين والمقاومة؟!
http://wata1.com/vb/showthread.php?t=8939 (http://wata1.com/vb/showthread.php?t=8939)
ويجد فيه كل من يهتم بالمنطق والموضوعية الكثير من الأدلة فيما قاموا به
ما رأيكم دام فضلكم؟

اسماعيل الناطور
03-21-2012, 09:15 AM
http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/483865_412839698731275_301643433184236_1782983_162 4457781_n.jpg

السلفيون لم يحترموه في مماته..ولو لدقيقة واحدة!

أثار امتناع عدد من النواب السلفيين عن الوقوف خلال دقيقة الصمت الذي دعا لها رئيس مجلس الشعب الدكتور محمد سعد الكتاتني الكثير من الجدل , فحين وضعها السلفيون في خانة العقائد الدينية التي تحرم على المسلمين التعزية في وفاة غير المسلم , أكد عدد من نواب البرلمان أن ما قام به هؤلاء يفتقر للحنكة و الحكمة التي تحتم التضامن مع طائفة مهمة من أبناء الشعب المصري .

و كان عدد من نواب مجلس الشعب المنتمين للتيارات السلفية قد رفضوا الوقوف دقيقة صمت حداد على وفاة البابا شنودة الثالث يوم السبت الماضي , و هو الأمر الذي علق عليه النائب في المجلس مصطفى النجار بالقول في تدوينه قصيرة على صفحته الشخصية على موقع التواصل الاجتماعى تويتر ' شكرا لكم لقد احزنتمونا جميعا ' .

جدير بالذكر أن نواب حزب النور السلفي و عدد آخر غيرهم قد غادروا قاعة مجلس الشعب قبيل اعلان رئيس المجلس سعد الكتاتني عن دقيقة الصمت حدادا على فقيد الأقباط و مصر البابا شنودة , هذا فيما اضطر من بقي منهم الى الجلوس بينما باقي البرلمان واقف تحية لروح الفقيد




الحقيقة أنا في صف من لم يقم دقيقة حداد لا على البابا ولا على أي شخصية مسلمة , فهذه البدعة والتي جاءت من الغرب , وليس لها أصول لا في الدين ولا في المعنى , هي صك نفاق من الحاضرين لموت إكرامه هو دفنه وقيمته هو ما بقى له من عمل طيب في أذهان الأحياء , أما أن نقف دقيقة حداد على هذا وذاك فهو دليل نفاق وليس دليل مشاركة أحزان , أما عن مصطفى النجار , فأنا أجده أغبى عضو قد تم إدخاله لمجلس شعب وهذا طبعا رأي شخصي

إباء العرب
03-21-2012, 11:01 PM
بأسجل إعجابي ببعض ما ورد في هذه الصفحة وخاصة بما يتعلق ببرنار ليفي .

اسماعيل الناطور
03-24-2012, 08:25 AM
بأسجل إعجابي ببعض ما ورد في هذه الصفحة وخاصة بما يتعلق ببرنار ليفي .

ـ سيادة الرئيس المخلوع هل تعرف من أنا ؟
بنرفزة _ بلاش كلمة مخلوع دي .. و اتكلمي بسرعة و قولي عايزة أيه مش شايفاني و أنا حالتي كرب و بيحاكموني مش عارف على ايه ؟
_ هل يبدو من كلامك أنك أصبت بالزهايمر ؟ ألم تعلم أن هناك ثورة حدثت و أن الشعب طالب بمحاكمتك على ما اقترفت يداك من جرائم خلال ثلاثون عاما هي مدة حكمك
_ يا بنتي اسمعيني و بلاش توجعي قلبي .. أنا غلبان و مضحوك عليّا و مجني عليه
_ سيادة المخلوع ,, قصدي الرئيس السابق .. هل أفهم من كلامك أنك تنكر كل التهم التي وجهت إليك
_ برضه حتقوللي تهم .. أنت مين حدفك عليا .. دفعوا لك كام عشان تغتاليني و تموتيني ناقص عمر
_ ناقص عمر أزاي .. أنت داخل على التسعين عاما يا جدو
_ تسعين أيه أيه أيه .. لا يا أمي .. دا أنتِ تخلفيني يا حبيبتي
_ واضح أن صدمة الثورة ضربت الأسلاك الدماغية و العقلية .. هل تقصد أن تدعي الجنون حتى تفلت من الإتهام ؟
_ هو مين اللي مجنون يا بنت أنتِ يا بنت .. و بعدين أنتِ مين بالظبط .. أنا لحد دلوقت مش عارف طلعتي لي من أيها داهية
_ أنا محاميتك يا مخلوع
_ و لما أنت محاميتي .. بتحرقي دمي ليه و نازلة تقولي مخلوع مخلوع و قربتي تغنيها بالربابة
_ ربابة ربابة .. أنت قديم خااااااالص .. الآن فيه دي جي و ساكسافون ..
_ و دا أيه يا هانم يا بتاعة المدارس يا مؤدبة
_ أنا عذراك يا مخلوع .. حتعرف منين الدي جي و أنت من أيام خماراويه
_ يا حرااااااس .. حد ياخد المصيبة دي من قدامي ..
_ خلاص بقى .. هزرنا كتير ندخل في الجد
متوجه لك ربعمائه تهمة و خمسة آلاف مصيبة و عشرين ألف كارثة .. فما هو قولك فيما نسب إليك من إتهامات
_ يا ضغطي اللي بيرتفع .. يا مرارتي اللي بتتفقع ... حد يمشّي المصيبة دي من قدامي دي قبل ما ارتكب الجريمة رقم مليون

( يتبع )

ـ سيادة الرئيس المخلوع هل تعرف من أنا ؟
بنرفزة _ بلاش كلمة مخلوع دي .. و اتكلمي بسرعة و قولي عايزة أيه مش شايفاني و أنا حالتي كرب و بيحاكموني مش عارف على ايه ؟
_ هل يبدو من كلامك أنك أصبت بالزهايمر ؟ ألم تعلم أن هناك ثورة حدثت و أن الشعب طالب بمحاكمتك على ما اقترفت يداك من جرائم خلال ثلاثون عاما هي مدة حكمك
_ يا بنتي اسمعيني و بلاش توجعي قلبي .. أنا غلبان و مضحوك عليّا و مجني عليه
_ سيادة المخلوع ,, قصدي الرئيس السابق .. هل أفهم من كلامك أنك تنكر كل التهم التي وجهت إليك
_ برضه حتقوللي تهم .. أنت مين حدفك عليا .. دفعوا لك كام عشان تغتاليني و تموتيني ناقص عمر
_ ناقص عمر أزاي .. أنت داخل على التسعين عاما يا جدو
_ تسعين أيه أيه أيه .. لا يا أمي .. دا أنتِ تخلفيني يا حبيبتي
_ واضح أن صدمة الثورة ضربت الأسلاك الدماغية و العقلية .. هل تقصد أن تدعي الجنون حتى تفلت من الإتهام ؟
_ هو مين اللي مجنون يا بنت أنتِ يا بنت ..
_ هو مين اللي مجنون يا بنت أنتِ يا بنت ...مين إللي ضحك عليك وقال إنه في ثورة , كل ثورة وأنت طيبة , طيب تعالي نشوف إيه إللي حصل في مصر من يوم ما ضحكوا عليكم شوية السلطة من علماني وديني وبلطجي وفيس بوكي , الفقر زاد , والأمن ضاع , ومجلس شعب لسه بيصرخ وبيصفق ويستنكر ويشجب ويقرر كالأطرش في الزفة , ضحكوا عليكي يابنت وقالوا ثورة , هو اللي حدث بس هم قرروا أن يعزولوني لكبر سني , والواد جمال مش عاجبهم , وعايزين يجيبوا أخوانهم المسلمين , علشان يضربوكم بيهم , ويمسحوا البلاط بكل من يقول بعد كده , الاسلام هو الحل , أنت فاكره الواد اسامة إبن بلادن , مش جابوه وأعطوه الأمان والسلاح , وبعدين رموه بالبحر للسمك , ثورة إيه يابنتي ...ضحكوا عليكم وحياة شرف أمي إللي كانت زعلانه مني وربنا إنتقم مني لإنني كنت مش كويس معاها , وما خبيش عليك , أهل غزة كانوا ليل نهار بيدعوا علي بالشلل , لكن للأسف هم كانوا مش فاهمين إني كنت عبد مأمور , والدليل إني رحت ولكن الحصار لسه موجود ..

مع تحياتي أخت منار , أعتقد أن الموضوع ممكن إخراجه عن الساخر إلى المؤلم

اسماعيل الناطور
03-24-2012, 08:26 AM
أستاذ اسماعيل


أردت من موضوعي الساخر أن أبيّن طريقة تفكير الرئيس السابق و الذي لا يقتنع حتى الآن بأنه مدان و ارتكب جرائم هو و نظامه في حق الشعب المصري على مدى عقود .. لازال يعيش دور الضحية .. و هكذا هو تفكير كل الجناة .. فلا أتذكر جاني أدان نفسه .. فكلهم أبرياء .. ضحك عليهم الشيطان أو غدر بهم الناس .. لا يرون الحقيقة إلا من وجه واحد و زاوية واحدة فقط
أما الثورة نفسها فكنا نتوقعها من زمن .. و لو لم تحدث كنا انفجرنا في انفسنا و متنا قهرا من كل ما رأيناه على مدى سنوات في حق مصر و المواطن المصري و كان ينتظرنا المصير الأسوء على يد ابن المخلوع و زبانيته
أما ما حدث بعد الثورة من انقضاض الأخوان و الجماعات الدينية على مجلس الشعب و الشورى .. فهذا لأنهم أكثر من استفاد بالثورة مستغلين لحالة التخبط في الشارع المصري و العاطفة الدينية لدى المواطن المصري التي تغلبت عليه و رغبته في تسليم البلاد لمن يتقون الله بعدما ذاقوا ويلات من لا يتقونه .. و الآن الشارع يستفيق من مغبة فعله و سوء تفكيره و شعبيتهم تتراجع بشكل كبير على الساحة المصرية
أما البلطجية و الحرامية و الانفلات فهذا أمر طبيعي لأننا لازلنا في مرحلة انتقالية و فلول النظام السابق تعمل بقوة لإجهاض الثورة و لازال الامن المصري يلملم شتاته و جراحه بعد تلك التصادمات العنيفة مع المواطنين
نحن نعيش ثورة حقيقية و لا ريب في ذلك
و لن ينال منها متسلق أو مستغل أو بلطجي أو حتى أجندات خارجية
فقط هي مرحلة مؤقتة كتوابع الزلازل و مخاض الولادة الصعب و بعد أن تستقر الأمور و نحن نقترب من النهاية و في طريقنا لانتخاب رئيس مصر القادم .. انتخاب حر و نزيه بلا تزوير و لا بلطجة .. و أيضا سيتحمل الشعب مسؤلية اختياره
فمهما حدث لن يكون أسوء من الماضي
و المخلوع الذي يظن أنه مجنيا عليه .. سيعيش خزي الدنيا و الآخرة
و لا أصدق أبدا أن هناك مؤامرات و أجندات أدت لحدوث الثورة الشعبية التي خرجت من قلب مصر لكل شوارعها و ميادينها
فكل هذه أوهام عند من لا يعرف الشارع المصري جيدا و عند من لايرى الصورة إلا من خلال زجاج سميك مشوّش و عند من ينبهر ببعض العصابات و الحركات التي يظن أنها قد تحرك العالم كيفما أرادت و هم في الحقيقة مجرد فقاعات لا يمكن أن تؤثر إلا في من تأثر بهم حد الإنبهار
شكرا لك أ أسماعيل
سيظل الموضوع ساخرا لأنه ينفس عن عقلية ديكتاتورية مريضة .. انفصلت عن الشارع من زمن و تركته للذئاب و الضباع و لازالت ترى الأمور بفكر مغيب و عقلية مريضة



و الآن الشارع يستفيق من مغبة فعله و سوء تفكيره و شعبيتهم تتراجع بشكل كبير على الساحة المصرية



أما البلطجية و الحرامية و الانفلات فهذا أمر طبيعي لأننا لازلنا في مرحلة انتقالية و فلول النظام السابق تعمل بقوة لإجهاض الثورة و لازال الامن المصري يلملم شتاته و جراحه بعد تلك التصادمات العنيفة مع المواطنين
نحن نعيش ثورة حقيقية و لا ريب في ذلك
و لن ينال منها متسلق أو مستغل أو بلطجي أو حتى أجندات خارجية

فقط هي مرحلة مؤقتة كتوابع الزلازل و مخاض الولادة الصعب و بعد أن تستقر الأمور و نحن نقترب من النهاية و في طريقنا لانتخاب رئيس مصر القادم .. انتخاب حر و نزيه بلا تزوير و لا بلطجة



ويتابع الرئيس المخلوع قائلا :

فقط هي مرحلة مؤقتة كتوابع الزلازل و مخاض الولادة الصعب, والله يابنتي عشت الوهم أكثر منك , وكنت فاكر إني مادامت أمريكا وإسرائيل راضيين عني وأنا والكرسي في أمان , والمصيبة إكتشفت إنهم أول المتآمرين علي وإلا ما سمعت بحكاية التمويل وكيف أفرجوا عنهم عينك عينك
والسؤال هما ما كانوا مش عايزني ليه ؟ دانا سرقت الشعب وسلمت العراق وحرقت غزة وخربت بيت السودان !!!ّ ...طيب ليه بيتآمروا علي ؟
ومن عشر سنيين وجمعيات مجتمع مدني و6 ابليس والبرادعي وغيره وغيره ....إفهمي يا بنتي أن الناس دول ما عندهمش أصل ولا كبير ...وفاتحيين العالم لهدف واحد ومن زمان , نسيتي بونابرت وإلا الصليبيين ولا الانجليز , والغريب إنك بتقولي فلول , هو أنا لو عندي فلول لها قيمة كان ضحك علي شوية عيال !!..دي شماعة جديدة بيحاولوا يكملوا الجريمة بيها , بلا فلول بلا توهان , بصي كويس وشوفي أهل الماسون عملوا إيه في الغرب قبل الشرق , وإذا إنت كنت فاكره المصريين بس اللي كانوا على الثورة ناويين , طيب تونس وليبيا واليمن وسوريا ...برضه كانوا على الثورة ناويين , طيب يا بنتي إشمعنا في الدول الثانية اللي أكثر منا لاصقة بالكرسي , ما كانوا على الثورة ناويين , يابنتي أخرجي من الصندوق الإعلامي المحبوسه فيه وإنظرى للصورة من خارج سجون الفضائيات .
وبتقولي إنتخاب رئيس حر !!!!...أهه ذقني إللي بحلقها كل يوم بدل ما أصبغها ...كفاية شعري اللي فاضح عمري ...الرئيس اللي جاي مغسول ومدهون وملفوف تسليم على المفتاح

اسماعيل الناطور
03-25-2012, 10:34 AM
أيه ده يا أستاذ اسماعيل

أنت ساخر كبير و أنا مش عارفة
أحيانا اتفق معك في أفكارك و أحيانا اختلف معك
فمتى أتفق و متى أختلف ؟
أتفق معك عندما تفكر بأسلوب المواطن العادي الذي يعيش الواقع و يتكلم من داخله .. مواطن عرف القهر و الظلم في ظل حكومات قمعية موالية للغرب الذي يبحث دائما عن الورقة الرابحة حتى و لو تخلى عن عملائه و باعهم للشيطان و يبحث عن الحقائق من خلال قراءة الأوراق جيدا
و أختلف معك حين تفكر بأسلوب الماسون و أتباعهم .. حين تنفخ في هذه الفقاعات الوهمية حتى تجعل لها واقع محسوس بغير حق على حساب تهيمش العقل العربي تماما و إظهاره بالمتخلف و الحمار و الساذج و المنقاد كالأعمى .. الذي لا يفهم و لا يعي كما فهمت ووعيت
يا سيدي نحن بشر لنا عقل و إرادة .. لنا إنتماء و فكر .. نستطيع أن نقرأ الوضع جيدا دون الحاجة لمشاهدة فضائيات و أبواق إعلامية عميلة
أنت دائما تنظر للأمور من زاوية واحدة لا تتخطاها .. و من خلال فكرة واحدة و تجعل العالم كله يدور في فلك هذه الفكرة
أنا أنظر من زوايا أخرى .. قد تكون بالنسبة لك غير هامة أو سطحية أو غريبة .. هذا حقك
فأنا احترم العقول التي تفكر و تستنتج و تطرح مقدمات و تعطي نتائج
لكن أيضا احترم الذين يحترمون الرأي الآخر و الفكر الآخر حتى و لو لم يتفقون معه
لذا فأني أتفق مع مشاركتك هذه في بعض الأمور و اختلف معك في غيرها
و أعتبر هذا الإختلاف أمر طبيعي .. أولا : لأن العقول تتفاوت و تختلف في تفكيرها و معطياتها و ثقافتها و نظرتها للأمور
ثانيا : أنا مصرية أشاهد الواقع عن كثب و من داخل الصورة و لن أراها بشكل جيد لو كنت أشاهدها من خلف إطار
و أنت تشاهدها من الخارج من زوايا أخرى سواء كانت فقاعات ماسونية أو ملصقان نتيّة أو تحليل شخصي للواقع المصري .. هذا حقك كمفكر و حقي أن احترم رأيك
فرأيي صواب يحتمل الخطأ و رأي غيري خطأ يحتمل الصواب
شكرا لك مرة أخرى أستاذ اسماعيل
و لنكمل الحلقات





و أختلف معك حين تفكر بأسلوب الماسون و أتباعهم .. حين تنفخ في هذه الفقاعات الوهمية حتى تجعل لها واقع محسوس بغير حق على حساب تهيمش العقل العربي تماما و إظهاره بالمتخلف و الحمار و الساذج و المنقاد كالأعمى .. الذي لا يفهم و لا يعي كما فهمت ووعيت


يا سيدي نحن بشر لنا عقل و إرادة .. لنا إنتماء و فكر .. نستطيع أن نقرأ الوضع جيدا دون الحاجة لمشاهدة فضائيات و أبواق إعلامية عميلة


و أختلف معك حين تفكر بأسلوب الماسون و أتباعهم .. حين تنفخ في هذه الفقاعات الوهمية حتى تجعل لها واقع محسوس بغير حق على حساب تهيمش العقل العربي تماما و إظهاره بالمتخلف و الحمار و الساذج و المنقاد كالأعمى .. الذي لا يفهم و لا يعي كما فهمت ووعيت
ويكمل الرئيس المخلوع
يا بنتي ما تاخذيش الأمور بعفوية زي ما حصل معايا , أنت عارفه طبعي كنت بحب الرياضة وأقوم من الفجريه ألعب وهاتك ياجري , أمر على المجلات والجرائد وآخذ نظرة عليها قدام الخدم والحراس يعني لزوم الرياسة بدون حتى ما أركز على العناوين , شفت خيبة أكثر من دي , وكل ما يحملوا تقرير أنده على عزمي السكرتير وأصرخ آيه ده يا عزمي , أنت بتشتغل إيه نصاب وبس!! , مش تخلصني من التقارير والملفات , شوف شغللك يا عزمي .....
وعزمي إكتشفت إنه عامل ريس وكمان بيرمي الملفات ويطنش , وأنا زي الملطوش ,
أقابل البرادعي وأعطيه وسام وأقول لنفسي ده راجل أمريكا ...يعني ما أقدرش أخاف منه ,
يقوللي تمويل وجمعيات وأمريكا وإسرائيل ...أضحك وأقول دي ناس غشيمة ومش عارفه إنني مشاركهم في الغاز وفاتح مصر على أبوابها ليهم , هما حيلاقوا زعيم زيي فين , كنت غبي بصراحة يابنتي , ولو سمعت كلام المخابرات كان زمان قاعد على قلوبكم وقلوب كل العوازل , ده انا لو كنت فاكر أن أمريكا بتغشني , كانت أخذت البنت اسماء محفوظ وأعطتها وزارة الشئون الاجتماعية , ووالواد وائل غنيم وزير الاتصالات , وبنت نجم نوارة اللي مش نوارة زوجتها لجمال إبني علشان يصحصح بدل الخيبة اللي هو فيها وماشي ورا صفوت وعز ولا الأهطل ,
أما الأخوان المسلمين ...كان أعطيت ابو الفتوح وزارة التعليم العالي والكتاتني رئيس مجلس الشعب والشورى كمان وبدون إنتخابات وسكر ودقيق , حتى الواد عمرو حمزاوي كان زوجته بسمة وطابور من الفنانات ومن زمان ...ورقصت في فرحه , وحولت يوم زفافه لعيد قومي
...لكن للأسف يا بنتي كنت غبي ولا بقرأ جرايد ولا بقرأ تاريخ , وفاكر إني أحسن من الرسول عند اليهود , ولا إنت ناسيه أن سيدنا محمد أعطاهم الأمان وبرضه في الآخر وضعوا له السم في اللحم , إمبارح لما قريت اللي كتبتيه للناطور ...زعلت منك وقلت الراجل ده لو كان إشتغل بدل عزمي كان أنقذني من الهبل إللي أنا فيه
وزماني قاعد في العروبة وأنتم برضه في التحرير بتصرخوا ...الشعب يريد إسقاط النظام

اسماعيل الناطور
03-25-2012, 09:42 PM
مساء الخيرات أستاذة منار


برافو بجد ... ليس للعمل الأدبى فهذا ليس بجد عليكِ و لكن لحوارك السياسى الرائع مع أ. الناطور

وعد منى يا أ. منار ... يوم 30 يونيو سيكون هناك موضوع بعنوان ( ثورة يا حمير ) ...على غرار الموضوعات الراقية للأستاذنا الناطور .. إن شاء الله


متابع ...


ويتابع الرئيس المخلوع ....يا أحمد أبو زيد أنا بحبك أوي ومتذكر دافعك عني وعن الضربة الجوية وهي تستحق أن تبقى في إنجازاتي , ومقدر لك ثقتك بي , وأنت عارف إني حأطلع براءة من التهم البايخة اللي بتقول إني أمرت بقتل المتظاهرين , دا أنا لو عملت كده ما كنش حسني ولا مبارك , ولا أصلا خليت واحد يطلع مظاهرة , أنا من أول يوم وصلت للحكم , وأنا واخذ نظرية ...خلي الشعب يفضفض وخلي الموظفين تنام وخلي على بابا يشتغل على كيفه المهم محدش ينام زعلان مني ,,,,للأسف وفي نهاية عمري لقيت الكل زعلان حتى كلنتون القمر زعلانة مش عارف ليه ....المهم في موضوعك عن الحمير ...إحسب حساب الحمير اللي صدقوا إن التهمة دي هي تهمة وبدل من يقدموني لتهمة إفساد الضمير والزراعة والصناعة قدموني لتهمة بايخة ما تنطبقش على واحد زيي حساس أقوي ويحب الفسح والمسابح والقصور والحال السايب

اسماعيل الناطور
03-27-2012, 08:25 AM
الأخ حسين
أشعر تماما وأفهم لماذا عدت إلى هذا الموضوع الطريف والذي يستحق المشاركة فيه , ليس لنقص العربية عن اللفظ المناسب لمثل تلك الحالات , ولكن لحاجة عرب هذا الزمان للضرب على الدماغ ليستقظوا مما هم فيه من تبعية فكرية تنم عن فقر وأمية في الوعي , لذلك سأعود وأذكرك بما شاركت , لرمي حجر في برك العقول التي لا تفهم أن العدو ما تسلل إليها , إلا بعد أن أعطى تعريفا للمثقف يناسب تعريف من يستطيع القراءة والكتابة وكلما كانت قدرته على الإعراب سليمة كلما كان يعتقد إنه مثقف , وأنا أثق أن والدي الذي لم يكن يحسن الكتابة كان مثقفا أكثر منهم , لإنه كان من أهل الربط والحل في زمانه , وكانت كلمته أعلى فهما من حاملي الشهادات !!!!, لذلك إستمر في نحتك فلا زالت (الكاثيوت) أجمل ما نحت ويناسب بعض متعلمي هذا الزمان
الأخ حسين
إنها "المِعْزُوطَيِِرية"
وفاعلها يمكن تسميته "المعْزطَيِِراتي "
فهناك الكثير من "المعزطيراتيين" "والمعزطيراتيات"



الأخ حسين
هي من باب المزاح الجاد
الأخ يوسف الديك والأخت آسيا الآن شاركا تقريبا بنفس الرأي
وعليه أحببت أن أكمل هذا المزح الجاد..............
فعلا
قد يكون اللفظ ثقيلا
ولكن هل تأملنا الفعل
فعل التعصب للأنا ووشم الصواب بالخطأ لدرجة عنزة ولو طارت
فاللفظ الثقيل هو مناسب للفعل
فهو أيضا ثقيلا وسفيها وغبيا
إذن المعزطيراوية هو وصف لحاله لا تطيقها نفسا سوية
وكان ينقصها تعبير آخر عن فاعلها
لذلك أجد في معزطيراتي تعبير مناسب لفاعلها
وهنا أيضا أخالفك أخي حسين فمعزطيري لا أجد فيها مفهوم لفظ ""طارت""
أما معزطيراتي فهو أكثر مناسبة لهؤلاء الذين أقفلوا العقل على ما عندهم
وحتى لو أتى غيرهم بما يقنعه أو يفحمه
فهو معزطيراتي لإنه
لا هو معزة
ولا طير
بل إنسان ينكر فعل " طارت"
وإن كان يراه هو وغيره بعين اليقين
وكل مزحة جادة وأنت بألف خير

اسماعيل الناطور
03-28-2012, 11:56 AM
وباعت أمريكا حميرها ....
السفير الأمريكي في سوريا يقول ...لدينا تأكيدات أن المعارضة السورية قد إنتهكت حقوق الإنسان في سوريا

اسماعيل الناطور
03-29-2012, 06:23 PM
كما أن هناك حميرا صدقوا الماسون الغرب في البحث عن حق الانسان , فساهموا بفوضى الخراب ( الحرية بعيدا عن الفطرة والضمير) , فكان خرابا في عدة بلاد عربية تحت ستار خلع الحاكم , فخلعوا الأمن والإستقرار وجلبوا مزيدا من الفقر والإحتلال , هناك أيضا حميرا في الوجه المقابل , حمير الدفاع عن الحكام , دون الوقوف بثبات حول الوطن والمواطن , إن هدف الشرفاء في هذه الفتنة أن يكون لهم دور في منع مزيدا من الانهيار , في منع مزيدا من الانقسام , في منع مزيدا من اللاوعي , وأقصد بوضوح لم الشمل , وأقصد بوضوح إستخدام العقل لكسب من تفترض به العداوة , إستخدام العقل في توعية الطرف الآخر ليكون لك ولا يكون عليك , لم نقصد بالحمير الشتيمة وقد كررناها عدة مرات , ولكن قصدنا بها ...كل من لا يريد أن يقدم مصلحة الوطن على مصلحة أخرى , المقياس بين الانسان والحمار هو هنا المقياس بين من يردم الفوضى وبين من يريد أن يشعلها من هذا الطرف أو ذاك , فكما وجدنا حميرا في ما أطلقوا عليه الجيش السوري الحر , نجد حميرا في نصرتهم للطرف الآخر , فبدلا أن ينصروه بمحاولة كسب الآخر , يحاولوا أن يهزموه بإثارة الآخر عليه .,...فلا حول ولا قوة إلا بالله ....نعم إن العقل إمانة وقليلا منا من يدركون معنى هذه الأمانة

اسماعيل الناطور
03-30-2012, 08:40 PM
و على ما سبق نقول ..

العسكرى إذا إمتلك فكرة الإنقلاب على الأخوان فإنه بفتقد القدرة على التنفيذ و أدواته بل إن الأخوان تستطيع الإنقلاب على العسكرى ...

لو تم إعادة تشكيل السلطة التشريعية ألف مرة سوف يحصل التيار الإسلامى على نفس النسبة و سوف تتصاعد مع التكرار ..


أحمد أبوزيد .



فضلت اليوم أتابع مجلس الشعب المصري ومناقشته لبيان الحكومة المصرية , بدلا من متابعة مؤتمر القمة العربي الهزيل والذي لو كان هناك عقلا عربيا سليما وواعيا لما يدور في عقل المواطن العربي ما أحرج نفسه وعقد هكذا مؤتمر , فلا قمة بدون قمم , ولا عربية بدون عرب , ولا مؤتمر تحت الحماية الأجنبية , ولا قرارات لرجال حكم لا يعترف بهم من جلسوا على كراسيهم , المهم ...قلنا بلاش مغص عقلي , ولنذهب لنشاهد البرلمان المصري , وأصدقكم القول ....أن المغص العقلي زاد وأنتج مغصا روحيا حتى الإختناق , فلقد خسر التيار الاسلامي فرصته في حكم مصر , كنا نظن إنهم بعيدون عن أخلاق سياسي الأحزاب الحكومية السابقة , فوجدناهم أشد غباءا وتفاهه لدرجة الكذب وتقديم الأسف ورفع الحصانة وتبرير الكذب والدفاع عن الباطل , لقد كانت مهزلة اليوم في مجلس الشعب المصري كفيلة بالقضاء على نواب المجلس , أرادهم الشعب ضميرا عنهم , فجلسوا على الكراسي إمعات لأحزابهم دون وعي , فرحين بالسلطة والعضوية لدرجة أن أحدهم يقف يتكلم فلا يهمه أحد , أعتقد أن المجلس لن يكمل دورته , وأن المجلس سيقوم أحدهم بحله قريبا , ليس عن طريق الإنقلاب كما يتكلم البعض دون وعي , ولكن عن طريق قرار قضائي , يسنده الشعب الذي أيقن إنه أخطأ في طريق الإنتخاب .


أحييك أحييك أستاذ الناطور لأنك قرأت على البعد المشهد السياسي

بعمق وحنكة وعبرت عما يردده الشارع المصري الآن من خلال هتافات ترفض
حكم الإخوان ..
أتفق مع حضرتك فيما ذهبت إليه فهذا البرلمان سيحل بحكم قضائي
من الدستورية العليا بسبب عدم التكافؤ ـ وقد حدث الترشح للانتخابات
على القوائم والمقاعد الفردية ــ كما حدث وسبق أن حُلت برلمانات سابقة
وإن حدث وأُعيدت الانتخابات فلن يتكرر برلمان 2011
أحييك أيها القدير ،،،
تقديري واحترامي












ماجي

اسماعيل الناطور
03-31-2012, 10:25 PM
بعد سماعي للمؤتمر الصحفي لجماعة الأخوان المصرية وطريقة عرضها لخيرت الشاطر مرشحا لرئاسة مصر , وما تضمنه التقديم من عرض لخلاف وتخالف ومخالفة لإدارة المجلس الأعلى العسكري لمصر ...أقول بل أتساءل ....
هل سيناريو فتح وحماس بعد إنتخابات الأراضي المحتلة سيتكرر في مصر بين الأخوان والجيش في مصر ؟
وهل ستكون هذه الإنتخابات آخر إنتخابات مصرية قبل التشرذم ؟
يقول عمرو الليثي مقدم برامج في قناة المحور أن زلازل حدث في مصر اليوم وما لنا إلا أن نتابع نتائج التوابع

اسماعيل الناطور
04-02-2012, 02:03 PM
نحن نفتخر بأعضاء برلمان مصر يكفينا فخراً هذه النسب تتواجد فيهم ...
50 % خريجوا سجون و معتقالات النظام السابق .
50 % يحملون الدكتوراه و الماجستير .
50 % يحملون القرآن الكريم .
50 % لا يملكون سيارات خاصة ...

يا احمد ابو زيد لو إستخدمت تعبير أنا بدلا من نحن , لكنت أكثر تعبيرا عن نفسك , فما يحدث في مصر الآن لا تنطبق عليه نحن في أي مجال
فلو كان التيار الاسلامي إسلامي كما نحن المسلمين نعرف إسلامنا لتقدم بمرشح رئاسي واحد وقبل كل ذلك لكان أكثر هدوءا وبعيدا عن النفاق والكذب السياسي , ولا أعتقد أنهم أنظف من تيار الناصرية الذي يدعيه البعض في مصر لهدم تاريخ عبد الناصر وليس الإقتداء به كرامة وعزة , أي تيار مصري لا يقف لوحدة مصر وكرامة مصر قولا وفعلا هو فعلا تيار قذر وبدون بكيني تلك اللفظة التي تحب أن تطلقها هنا , لقد إنكشف البعض في قضية التمويل
فمن خاف أمريكا ورضى بالمذلة هو بكيني المقام والكرامة , ولا تقول لي فعلان أو علان إشتراكي أو سلفي أو ناصري وتلك المسميات التي يسخر بها المنافقون من الرأي العام تحت أقنعة والفاظ , التيار الاسلامي لا يمثله أحد وإلا كنا أنا وأنت والقارئ الذين يقول لا اله إلا الله خارجين عن الاسلام
أتركوا الاسلام في حاله وإلعبوا سياسية ونفاق وكذب وتزوير وسكر ودقيق كما يحلو لكم , أنت يا ابو زيد أراك تعيش مع القوي على الساحة , أيام مبارك كنت المدافع الأول , والان آراك المدافع الأول عن من وصلوا للبرلمان , وهذه الخصلة تفقدك الحكم على الأمور كما ينبغي , وهنا تورد إحصائية لطيفة عن من دخلوا السجون وحاملي الشهادات في البرلمان , وتتناسى أن هذه القائمة تنطيق على أي مجلس ولو كان مجلس حقوق الشواذ , الكل دخل السجون والكل يحمل شهادات , لذلك فمقياس اليرلمانات ليس مثل هذا المقياس , المقياس هو ما قدمه من فعل حقيقي لمصلحة الوطن , لذلك أعود وأقول لك أن البرلمان الحالي لن يعود لمصر مرة أخرى , وقد يكون تمهيدا لضرب المعنى الديني الحقيقي في نفوس المصريين بأكثر منه تيارا اسلاميا , المسلم لا يكذب ولا يتكبر ولا ينافق ولا يتظاهر ولا يتصارخ ولا يقول إلا أحسن القول , هذا المسلم ....أما ما نراه هو نوعية من بشر لا تختلف عن سابقيهم بحثا عن كراسي ولجان وتحايل سياسي






الجزئية الأولى ...

عندما نتكلم عن نتائج آى إنتخابات فى ظل حكم ديمقراطى نقول إن المجمع الإنتخابى قد إختار فلان بنسبة كذا و يصبح فلان هو إختيار المجمع الإنتخابى بالكامل ...

لذلك عندما نقول إن التيار الإسلامى قد إختاره الشعب المصرى فهذا وفقاً للأنظمة الديمقراطية تعبيراً صحيحاً ...

لذلك ذكرت كلمة نحن ... لأنها الصحيحة و الأصح ...

الجزئية الثانية ...

علاقة الإنسان بربه علاقة خاصة جداً و ليس من حق آى فرد أن يحدد نوعية و طبيعة العلاقة للأخرين ... من الخطأ أن نقول إسلامنا و أسلامهم ...
و هنا نطلب من حضرتك أن توضح لنا ما هو إسلام الأخوان المسلمين الذى يختلف عن إسلامنا

الجزئية الثالثة ...

ترفض مواصفات البرلمان المصرى و لم تضع لنا مواصفات البرلمانيات
و نطلب هنا أو تضع لنا مواصفات البرلمان و مقارنتها بمواصفات البرلمان المصرى . حتى نتعرف سوياً على أخطأ البرلمان المصرى ...

الجزئية الرابعة ...

هذا هو إختيار الشعب المصرى ... ولا يجب أن يخرج علينا من ينصب من نفسه ناقداً و عالماً عن 35 مليون مصرى ... خاصة إن نجاح الأخوان لا يقتصر على البرلمان بل وصل إلى جميع النقابات المهنية التى تضم علماء مصر و مفكريها ...

الجزئية الخامسة ...

برلمان الشواذ .... لا يوجد به حفظة القرآن الكريم .. و هذه سقطة كبير كيف تصف صاحب القرآن الكريم بالشاذ ... العلماء هم ورثة الأنبياء

الجزئية السادسة ..
قضية التمويل الأجنبى ... ما شأن البرلمان بها و ما هو دوره ما هو القرار الذى صدر منه حتى نحاسبه عليه ؟؟؟؟

الجزئية السابعة ...

ما يخص الركوع لأمريكا فى قضية التمويل الأجنبى ...

هناك متصفح قد وضعته فى هذا الشأن يمكنك الرجوع إليه حتى تعرف حقيقة الصورة بشكل كامل ...

الجزئية الثامنة ...


تصدر أحكام على منظمة تشريعية و تطلب منها تحقيق أفعال تنفيذية و هذا خلط كبير فى المعيار الذى تحكم به
و كيف نحكم على أداء برلمان أو آى منظمة أو فرد و عمره لا يتجاوز شهران فقط لا غير ... و فى ظل مرحلة غير طبيعية حيث يعمل تحت ضغط تفاعلات فترة إنتقالية بعد ثورة شعبية ....


الجزئية التاسعة ...

نعم دافعت عن مبارك و سوف أدافع عنه حتى أخر نفس يخرج من صدرى و هاجمت مبارك و سوف أظل أهاجمه و آيضاً حتى أخر دقيقة فى حياتى ..

و نفس الموقف دافعت و هاجمت عن جمال عبد الناصر و السادات و صدام حسين و حافظ الأسد ..

أدافع عن الإيجابيات و أهاجم السلبيات ...
أحمد لله إن قلمى لم يتخد قائداً رباً و إلهاً له ..
و أدافع مثل العبد لهُبْله ....

و إذا ألقينا الضوء على نقاط الإيجابية فى حكم مبارك سنجد الأتى : -

1 ) حافظ على الجيش المصرى و منع إستدراجه فى حروب صبيانيه هزليه سواء فى 2006 و حرب تموز أو فى 2009 و حرب غزة ... حافظ على الجيش المصرى فى الثمانيات حين خطط لإستدراجه فى حرب لبنان حين دخل و إكتسح شارون الجنوب اللبنانى و إحتل بيروت بدعوة و مساعدة من بعض الفصائل اللبنانية بهدف تصفية المقاومة الفلسطينية و على رأسها ياسر عرفات و حدث أكبر مجزرة فى صبرا و شتيلا بيد الصهاينة و أتباعهم من الفصائل اللبنانية ...
و لولا تدخل مبارك و ضمان خروج آمن للمقاومة و قائدها من لبنان إلى تونس تحت حماية الأسطول المصرى و سلاح الطيران المصرى لكان قضى تماماً على ياسر عرفات و رجال المقاومة الفلسطينية و على منظمة فتح بالكامل ...

أدافع عن موقف مبارك فى حرب الكويت حين سمح بالخروج الأول و الأخير فى عهده للجيش المصرى خارج الحدود المصرية و تواجد فى ثلاث دول عربية هى السعودية و الإمارات و سلطنة عمان ...

لولا وجود هذا الجيش لإكتسح صدام المنطقة الشرقية من السعودية و جميع دول الخليج و قام بإحراق أبار البترول و كان وقتها من الصعب خروجه ...

دافعت عن مبارك ضد الحملة الشرسة الكاذبة بحصار غزة ... لو أراد مبارك حصار غزة لمات أهل غزة

دافعت عن مبارك حين خرجت أقلام مشوهة تطالب بدخول مصر الحرب ضد إسرائيل و رافعة شعار الحرب ضد إسرائيل حتى أخر جندى مصرى ..

دافعت عن مصر و شعب مصر حين وجدت أقلام تصف الشعب المصرى بالمنبطح و إنبطاحه سبباً فى وجود مبارك و كم ضحكت على هذه الظواهر الصوتية التى لا تستطيع أن تنقد أنظمة الحكم فى بلادها و هى تعتلى نسائها و فى غرف نومها ...


أدافع عن مبارك فى مجال الإنجازات الإقتصادية التى تحققت فى عهده و إرتفاع حجم الصادرات المصرية من 20 مليار إلى 100 مليار جنيه و تحقيق معدل نمو للإقتصاد القومى يبلغ 7 % و هو معدل عالى جداً ..

و هنا فقد ولا يوجد مكان أو رآى أخر تقدمت بالإعتذار بشأن عدم تحقيق العدالة الإجتماعية فى توزيع الدخل القومى و إن الفترة الزمنية التى حكم فيها مبارك كان يمكن تحقيق نمو إقتصادى أكبر من المحقق بالفعل ..

و هنا هى شجاعة أدبية تحسب لقلمى و لا تحسب ضده
و لكن هناك البعض عندما يفشل فى الحوار مع قلمى فإنه يلجأ إلى الهروب مع إلقاء نقد إنك كنت مع مبارك

ملقوش فى الورد عيب قالوا أحمر الخدين ...

سبحان الله على أقلام سجدت لزعمائها ....

أنتظر الرد على التساؤلات المطروحة ...

هذا رد مختصر حتى لا نخرج عن صلب الموضوع


أحمد أبوزيد

اسماعيل الناطور
04-02-2012, 02:07 PM
الجزئية الثالثة ...

ترفض مواصفات البرلمان المصرى و لم تضع لنا مواصفات البرلمانيات
و نطلب هنا أو تضع لنا مواصفات البرلمان و مقارنتها بمواصفات البرلمان المصرى . حتى نتعرف سوياً على أخطأ البرلمان المصرى ...

الأمر أبسط مما تتصور , ويبدو إنك تريد أن تقول للقارئ أن البرلمان المصري لا يختلف عن أي برلمان آخر , فالكل يشتغل سياسية بكل مساؤيها من صراخ ونفاق وكذب وتحايل على المعاني , والبحث عن مصالح حزبية وشخصية ضيقة , وهنا أتفق معك , بل أبصم لك ...لكن للأسف البرلمان المصري يجب أن يكون مختلف عن أي برلمان آخر في الدنيا لإنه برلمان جاء على أساس ديني دين الاسلام العظيم , لذلك يجب أن يكون نظيفا ولا يشبه أي برلمان آخر , وإلا فالحزب الوطني كان أجدى لإنه على الأقل كان يحتوي مفكرين ورجال خبرة ودلة وليس دراويش أو قليلي الخبرة أو مستتر خلف دين لا يعمل به , لذلك كان لنا موضوع
إسمه مجلس الشعب وسطحية التفكير الإستراتيجي , ننقل منه بعض المشاركات
لو سألنا سؤال بريئ جدا
ماذا فعلت إسرائيل إثناء الربيع العربي والربيع الماسوني ؟
هل خافت وإرتعشت وقالت الأشاوس من بني الإسلام قادمون للأقصى ؟
هل سمعنا بعرض سلام أو مفاوضات أو تراجع أو حتى كلمة ود لمن سرقوا آراضيهم وكراماتهم ؟
الحقيقة كل هذا لم يحدث , وما حدث كان العكس تماما , في الخليل تم السماح لليهود بالدخول للمسجد الإبراهيمي , وفي الأقصى تم السماح لليهود بالتجوال كيفما يريدون , وفي غزة يتصايدون من يريدون ويقصفون وقتما أرادوا التسلية والعقاب بالدم الفلسطيني , وفي الضفة يغيرون ويأسرون ويخطفون ويعربدون وقتما شاء الجندي الإسرائيلي إذلال من كان فدائي من فتح , وفي سيناء التهريب والتسلل إلى مصر على عينك يا تاجر , وليس هذا فقط بل أن الحكومة الإسرائيلية وافقت على مشروع إيلات إسدود ومنافسة قناة السويس ومصر كمرحلة أولى من مشروع قناة البحرين , ووافقت أيضا على مشروع مد أنابيب نقل البترول إلى عسقلان ومنافسة سوريا على خط أنابيبها المغلق من أيام غزو العراق , إسرائيل تعمل وتعمل وإخوتنا في الربيع يتناقشون ويتصايحون ...وليس هذا فحسب , بل يقتلون أي إحترام لكلمة عربي ....
أتعجب لماذا لم يناقش لغاية هذه اللحظة مجلس الشعب المصري أي قضية إسلامية عامة أو عربية تحت منطق وأعدوا لهم ما إستطعتم من قوة , الأغرب من ذلك أن تجد لا فرق بين نظام مبارك للسياسة الخارجية وبين نظام الأخوان , الاتفاقيات التي رفضوها لمبارك , أصبحت الآن إتفاقيات ومواثيق دولية , والمعونة التي كانت مرفوضة أصبحت الآن جزء من إتفاقية كامب ديفيد وعلى أمريكا أن تقدمها لمصر تحت بنود الإتفاقية .....السؤال للقارئ ...إذا وجدت شيئا يختلف به الإسلام السياسي عما كان يقوم به مبارك ...فلتساعدنا وتكشف عنه , لإننا نثق أن الربيع لم يكن إلا ربيع الماسون....حتى شتيمة رأس الجيش أصبحت عادي في زمن قلة الأدب



هل يتذكر أحدكم الحائط الحديدي الإسمنتي الذين زرعه نظام حسني مبارك على الحدود بين غزة ومصر ؟



من نسى الموضوع فعليه أن ينعش ذاكرته بالعودة إلى موضوع قناة البحرين والذي لا زال موجودا في الملتقى الخاص
http://www.almolltaqa.com/ib/showthread.php?39239-%de%e4%c7%c9-%c7%e1%c8%cd%d1%ed%e4(%d1%dd%cd (http://www.almolltaqa.com/ib/showthread.php?39239-%de%e4%c7%c9-%c7%e1%c8%cd%d1%ed%e4(%d1%dd%cd))
ولكن ليس هذا الموضوع , الموضوع هو أن الأخوة في جماعة أخوان مصر أقاموا الدنيا على الموضوع وهم على حق بذلك
إلا أن الغريب أن لا أحد منهم يذكر الآن الموضوع بعد أن وصلوا للبرلمان , ولم يشكل أحدا لجنة تقصي حقائق ولا حتى مناقشة الموضوع

وكأن الأمن القومي المصري لن يتحقق إلا بمطادرة الداخلية وشتم الجيش وإهانة المجلس العسكري المصري , على العموم لا زال الوقت مبكرا لنصدر الحكم على برلمان ما بعد الثورة





نعم مقياس خاطئ لو كنت أقصد ذلك , ولكن لو رجعت للمشاركة , لوجدت إني إنتقدت المجلس لهذه المناقشة العلنية ودون لجنة تقصي حقائق ولدرجة أن رئيس المجلس الذي أحترمه لشخصيته القوية إلا إنه إعتمد تغيير تعبير أزمة إلى ثورة وتعبير تجميد إلى قطع علاقات دون العودة إلى الوزارات المختصة وأجهزة الدولة الجيش والمخابرات لإعتماد تعابير مصيرية , هنا كانت السطحية والتى كانت تعتمد إرضاء بعد الأصوات العالية في البرلمان أو خارجه دون تحويل الأمر بكامله إلى مؤسسات الأمن القومي المصري , بالتأكيد هناك في مصر عباقرة ولكنهم ومع هذا الصراخ أصبحت آياديهم مرتعشة وهذه ليست مصر التي كانت تطلب فتطاع , رحمة الله على عبد الناصر الذي خرج يوما وفي خطاب علني وقال : ,,,الأسبوع القادم مؤتمر قمة عربي ...فكان
, ورحم الله السادات الذي قال يوما ....مصر لا يقاطعها أحد بل هي التي تقاطع وفعلا إنسحب من الجامعة العربية
, عتبي على مجلس الثورة
أن لا يكون مجلس صراخ على توافه الأمور , يجب أن يكون مجلس ثورة يخيف العدو ويجبر المتردد على الإقدام , لكن للأسف أجده لغاية هذه اللحظة مجلس غرام وإنتقام , غرام في الغرب وإنتقام من كل من كان ضدهم يوما ولو كان على حق ,
لماذا قتلوا السادات ؟
أليس من أجل كامب ديفيد كما قالوا
أم إنهم كانوا إمعات ومغيبين وبدون عقل ونفذوا ما طالبهم بهم البعض
, اليوم تنكشف الحقيقة ,
فكل من يظهر إنه مع كامب ديفيد والمعونة والاتصالات مع الغرب هو منافق دجال يبحث عن الكرسي ولا فرق بينه وبين مبارك إلا باللحية فلقد كان مبارك بدون لحية وهم بلحية
أما الفعل والإسلام فما زال ينتظر منهم الكثير , لقد بدأنا بالترويج للمعونة المصرية للشيخ حسان ...
فهل فعل مجلس الأخوان شيئا ؟
...والمعونة هي من الربا الواضح على الأقل [/color]

اسماعيل الناطور
04-02-2012, 02:10 PM
الجزئية الخامسة ...

برلمان الشواذ .... لا يوجد به حفظة القرآن الكريم .. و هذه سقطة كبير كيف تصف صاحب القرآن الكريم بالشاذ ... العلماء هم ورثة الأنبياء

سأعود لنقل ما كتبت وبعدها نشرح


وهنا تورد إحصائية لطيفة عن من دخلوا السجون وحاملي الشهادات في البرلمان , وتتناسى أن هذه القائمة تنطيق على أي مجلس ولو كان مجلس حقوق الشواذ , الكل دخل السجون والكل يحمل شهادات , لذلك فمقياس البرلمانات ليس مثل هذا المقياس , المقياس هو ما قدمه من فعل حقيقي لمصلحة الوطن ,
قلنا مجلس حقوق الشواذ ولم نقول برلمان الشواذ , والفرق بين الإثنين أن هناك فعلا مجالس لحقوق الشواذ وليس هناك برلمان للشواذ ,ولكن أنت تعلم إننا قلنا قولنا على سبيل التوضيح وأكملنا بأن العمل هو الفيصل ومع ذلك أسألك
وهل لا يوجد شواذ يحفظون القرآن ؟
يا أحمد ليس كل من حفظ القرآن عمل به , وما قضية البلكيمي ورفع الحصانة عنه لإنه كذاب وهي في الاسلام كبيره فقد يزني المؤمن ولكنه لا يكذب
قضية البلكيمي مثال بسيط , على الفرق بين الحفظ وبين العمل بالقرآن , والموضوع لا أريد أن أطيل فيه وأترك لعقلك أن ينظر نظرة واسعة لكل الطوائف والتي تدعي الاسلام وهي منه براء رغم إنها تحفظ القرآن وتتواجد في برلمانات العالم

اسماعيل الناطور
04-02-2012, 02:11 PM
الجزئية السابعة ...

ما يخص الركوع لأمريكا فى قضية التمويل الأجنبى ...

هناك متصفح قد وضعته فى هذا الشأن يمكنك الرجوع إليه حتى تعرف حقيقة الصورة بشكل كامل ...

طبعا لا يمكن إستخدام هذه الجملة ( هناك متصفح قد وضعته فى هذا الشأن يمكنك الرجوع إليه حتى تعرف حقيقة الصورة بشكل كامل ...
) مع اسماعيل الناطور لإنك تعرفه قارئ جيد على الأقل وخاصة إنه تابع التمويل وقبل أن تدري عنه أنت شيئا , لذلك أنا أنصحك بقراءة ثورة الحمير سطرا بسطر لإنه موضوع كان فكرة خطرت على متابع فتحولت إلى قضية دولية شهد عليها ما نكتبه الآن , لذلك إذا كان عندك ما يضيف , فيمكنك نقله هنا لتشبع القارئ ولا تهرب من إجابات تستحق , قضية التمويل وإخراج العملاء بطائرة عسكرية أمريكية هو إهانة للشعب العربي وليس للشعب المصري فقط لذلك لا أريد أن إستخدم (ألفاظ سرير النوم) التي تكتبها دون أن تدري ما معناها , لكنك لو علمت ما إستخدمتها ,وكان بودي أن أعرف من هم الذين تعتلي ..نساءهم !!! ...ولكن عذرتك لإنك إستخدمت ألفاظ البكيني في غير موضعها وهنا تستخدم عبارة أتركها لك لتفهم ما معناها عند عربي مسلم , ولكن من الجهل ما قتل !!!, وأعتقد إنك هنا لم تدافع عن مصر ولا عن شعب مصر , لأن أحدا جاهل كان سيرد عليك بما إتهمت لو كان عصبيا بجهل يكتب ولا يتدبر بما يكتب


دافعت عن مصر و شعب مصر حين وجدت أقلام تصف الشعب المصرى بالمنبطح و إنبطاحه سبباً فى وجود مبارك و كم ضحكت على هذه الظواهر الصوتية التى لا تستطيع أن تنقد أنظمة الحكم فى بلادها و هى تعتلى نسائها و فى غرف نومها ...


أما ما دور الأخوان , فهو أوضح مما ترى يا أخي أحمد , هناك شكر علني من نائب الرئيس الأمريكي لجماعة الأخوان لمساعدتهم في إطلاق سراح العملاء ولم يقم أحدا منهم بنفيه , وهناك برلمان لهم إخواني الشكل والعدد ويمكنهم إسقاط من يريدون لو كانوا منها براء , وهناك قوة شعبية وميدان ومليونيات هم أقدر على جمع الناس لو كانوا منها براء , إنهم جزء من الرضى الأمريكي شئت أم أبيت , بل أن تقديم خيرت الشاطر كمرشح هو أمر وليس إختيار , وخلال هذا الاسبوع ستفهم لمن كان الأمر والنهي والقوة ودون أن نجيز لأنفسنا ألفاظ (تعتلى نسائها و فى غرف نومها )

اسماعيل الناطور
04-02-2012, 02:13 PM
الجزئية التاسعة ...

نعم دافعت عن مبارك و سوف أدافع عنه حتى أخر نفس يخرج من صدرى و هاجمت مبارك و سوف أظل أهاجمه و آيضاً حتى أخر دقيقة فى حياتى ..

و نفس الموقف دافعت و هاجمت عن جمال عبد الناصر و السادات و صدام حسين و حافظ الأسد ..

أدافع عن الإيجابيات و أهاجم السلبيات ...
أحمد لله إن قلمى لم يتخد قائداً رباً و إلهاً له ..
و أدافع مثل العبد لهُبْله ....

نعم أشهد الله إنك هاجمت مبارك وبشدة ولكن ليس قبل أن تطمئن إنه أصبح سجينا وبقوة
ولكن قبل الثورة كان اللاعب الماهر بتاع الثلاث ورقات يضحك على أمريكا وإسرائيل والعرب أليس كذلك ؟
لذلك فهذا القول
أدافع عن الإيجابيات و أهاجم السلبيات ...
أحمد لله إن قلمى لم يتخد قائداً رباً و إلهاً له ..
و أدافع مثل العبد لهُبْله ....
لا أجده ينطبق إلا على من يطارد اللص بعد أن طاردوه كل الجيران ( يعني ظاهرة صوتية بالمعنى الذي تفهم )
وعلى القارئ أن يعود لموضوع حوار ساخن بين ابو زيد وغادة



و إذا ألقينا الضوء على نقاط الإيجابية فى حكم مبارك سنجد الأتى : -

1 ) حافظ على الجيش المصرى و منع إستدراجه فى حروب صبيانيه هزليه سواء فى 2006 و حرب تموز أو فى 2009 و حرب غزة ... حافظ على الجيش المصرى فى الثمانيات حين خطط لإستدراجه فى حرب لبنان حين دخل و إكتسح شارون الجنوب اللبنانى و إحتل بيروت بدعوة و مساعدة من بعض الفصائل اللبنانية بهدف تصفية المقاومة الفلسطينية و على رأسها ياسر عرفات و حدث أكبر مجزرة فى صبرا و شتيلا بيد الصهاينة و أتباعهم من الفصائل اللبنانية ...
و لولا تدخل مبارك و ضمان خروج آمن للمقاومة و قائدها من لبنان إلى تونس تحت حماية الأسطول المصرى و سلاح الطيران المصرى لكان قضى تماماً على ياسر عرفات و رجال المقاومة الفلسطينية و على منظمة فتح بالكامل ...

أدافع عن موقف مبارك فى حرب الكويت حين سمح بالخروج الأول و الأخير فى عهده للجيش المصرى خارج الحدود المصرية و تواجد فى ثلاث دول عربية هى السعودية و الإمارات و سلطنة عمان ...

لولا وجود هذا الجيش لإكتسح صدام المنطقة الشرقية من السعودية و جميع دول الخليج و قام بإحراق أبار البترول و كان وقتها من الصعب خروجه ...

دافعت عن مبارك ضد الحملة الشرسة الكاذبة بحصار غزة ... لو أراد مبارك حصار غزة لمات أهل غزة

دافعت عن مبارك حين خرجت أقلام مشوهة تطالب بدخول مصر الحرب ضد إسرائيل و رافعة شعار الحرب ضد إسرائيل حتى أخر جندى مصرى ..

دافعت عن مصر و شعب مصر حين وجدت أقلام تصف الشعب المصرى بالمنبطح و إنبطاحه سبباً فى وجود مبارك و كم ضحكت على هذه الظواهر الصوتية التى لا تستطيع أن تنقد أنظمة الحكم فى بلادها و هى تعتلى نسائها و فى غرف نومها ...


أدافع عن مبارك فى مجال الإنجازات الإقتصادية التى تحققت فى عهده و إرتفاع حجم الصادرات المصرية من 20 مليار إلى 100 مليار جنيه و تحقيق معدل نمو للإقتصاد القومى يبلغ 7 % و هو معدل عالى جداً ..

و هنا فقد ولا يوجد مكان أو رآى أخر تقدمت بالإعتذار بشأن عدم تحقيق العدالة الإجتماعية فى توزيع الدخل القومى و إن الفترة الزمنية التى حكم فيها مبارك كان يمكن تحقيق نمو إقتصادى أكبر من المحقق بالفعل ..

و هنا هى شجاعة أدبية تحسب لقلمى و لا تحسب ضده
و لكن هناك البعض عندما يفشل فى الحوار مع قلمى فإنه يلجأ إلى الهروب مع إلقاء نقد إنك كنت مع مبارك

ملقوش فى الورد عيب قالوا أحمر الخدين ...

سبحان الله على أقلام سجدت لزعمائها ....

أنتظر الرد على التساؤلات المطروحة ...

هذا رد مختصر حتى لا نخرج عن صلب الموضوع


أحمد أبوزيد









حروب صبيانيه هزليه سواء فى 2006 و حرب تموز أو فى 2009 و حرب غزة
حروب صبيانية للأسف أنت فقدت عقلك عندما تقول ذلك , ولذا يجب أن نذكر القارئ بتلك الصبيانيات
حرب 2006 قتال لأكثر من ثلاثين يوما بكل أنواع السلاح جيش وطائرات وتدمير الجنوب اللبناني وفي مقابله حرب صاروخية لأول مرة على إسرائيل تعمل على تهجير نصف سكان إسرائيل , صمود , وثبات , ودحر للعدو , وكسر نظرية التفوق الاسرائيلي وبتر ذراع الجيش ومدة حرب تجاوزت حرب اكتوبر بالمدة والعتاد
حرب 2009 قتال لأكثر من ثلاثين يوما بكل انواع الأسلحة على شعب أعزل ومقاومة لا تحمل سلاحا إلا شخصيا وصواريخ صنعها المحاصر من مبارك , وفسفور وقتل وحرق ورغم ذلك تشبت مليون ونصف فلسطيني بقطعة أرض لا تتجاوز مساحة حي بالقاهرة , إيمانا منه أن العرب المسلمين قد ماتوا أو أن هناك من إستضعفهم لدرجة الذل , وعقد العزم على الله , وبذلك لم يطلب أحدا من الجيش المصري شيئا , ولم يحاول إستدراجه , فليس له مال ليدفع لمبارك حتى يرسله هنا أو هناك كما حدث من مهازل بعد أن مات مجدد الكرامة المصرية الراحل ابو خالد
و لولا تدخل مبارك و ضمان خروج آمن للمقاومة و قائدها من لبنان إلى تونس تحت حماية الأسطول المصرى و سلاح الطيران المصرى لكان قضى تماماً على ياسر عرفات و رجال المقاومة الفلسطينية و على منظمة فتح بالكامل ...
نعم لولا مبارك ما خرج ياسر عرفات من بيروت , فلم تكن شهامة , ولكنها كانت آخر فصول المؤامرة على المقاومة الفلسطينية والتي تركها مبارك لحصار دام أكثر من ثلاث شهور هي وسكان بيروت ولم نجدك ولم نجد بكائيات حقوق الانسان والتي يبيعها البعض الآن على الوضع السوري , بكائيات حقيرة وحقارتها لإنها تتفق مع بكائيات أمريكا والغرب على السوري بينما نفس القوى حرقت نفس الانسان في غزة وبيروت وبغداد , ياليث مبارك لم يتدخل ولم يكمل جزء المؤامرة الأخير بالمشاركة في رحيل عرفات وللأسف تقول في غشامة تحت حماية الأسطول المصري , وهل يحمي الأسطول المصري سفينة بينما يترك عاصمة عربية تداس بأحذية بني صهيون , ولكنه الكلام كلام وهل هناك من يحاسب على كلام يكتبه إنسان وهو في بيته وهو لا يعلم وقد يعلم أن الحقائق أبعد بكثير عما يكتب , يا ليث ياسر عرفات مات وشبع موتا قبل أن يخرج من بيروت ويتخلى عن سلاحه ويموت ذليلا محاصرا في مكتبه وتحت سمع وبصر مبارك صاحب الاسطول والطيران

أدافع عن مبارك فى مجال الإنجازات الإقتصادية التى تحققت فى عهده و إرتفاع حجم الصادرات المصرية من 20 مليار إلى 100 مليار جنيه و تحقيق معدل نمو للإقتصاد القومى يبلغ 7 % و هو معدل عالى جداً ..

وهنا سوف أترك للشعب المصري قد يرد عليك أحدهم , ويشرح لك حال مصر إقتصاديا , وكيف أن ديون مصر , وفساد الزراعة والصناعة , وشيوع البطالة , وتهجير ملايين المصريين للعمل في البلاد العربية وبالطريقة التي تعرفها جيدا , وأخيرا ....لو فعل مبارك ما تقول ...لكانت الثورة عملا عبيطا قام به مجموعة من العبطاء , فكيف يقذفون زعيما بالحجارة حقق لهم فرق صادرات بهذا الحجم

اسماعيل الناطور
04-02-2012, 03:24 PM
لا يمكن فهم الموضوع عن طريق العدوى بالفيروسات , بل يمكن الإقتراب منه بمعنى التطعيم الإجباري بفيروس السمع والطاعة لأولي الأمر في الحكومة العولمية التي تدير هذا العالم , والتي أصبحت أقترب أن الهدف الأول في الربيع العربي كان مصادرة ليبيا , وما كان يجري في تونس ومصر واليمن وسوريا , ما هو إلا لإشغال القوى التي لها تأثير حول تلك النقطة بالذات , وإذا تم ما يعتقده المهدي , فإن الأمر يصبح أكثر وضوحا .....هذا إحتمال ...وإحتمال فقط ....أما الأهداف الأخرى مثل التقسيم , فأوانها حسب ما تنتجه الفوضى , الفوضى التي إن لم تنجح الآن , فلسوف يتم التخطيط لها في ربيع قادم ....إحتمال ...ولكن إحتمال معاه عصر ولكل عصر رجال ورؤساء , ما علينا إلا إنتظار قائمة مرشحي الرئاسة الرسميين وبعدها ...نلاحق ...إحتمال إحتمال ...وكل إحتمال وأنت بخير يامحمد برجيس



هل إعلان الشاطر ترشيحه شطارة أم غباء أم صفقة ؟
تعالوا لنحسبها وفقا لما حدث في الانتخابات لمجلس الشعب فقد أشارت النتائج القوائم في المرحلة الأولى أظهرت تقدم حزب الحرية و العدالة بنسبة بلغت اكثر من 36% من الأصوات ، وتلتها قائمة حزب النور السلفي بنحو 26% من الأصوات. بينما حصلت القوائم الليبرالية الست مجتمعة على ما يقرب من 29% من اصوات الناخبين. بما يفيد أن نظام مبارك إحتفظ ب 100-( 36+26+29)=9 % , فلو أخذنا تلك العينة وهي طبعا أحسن الظروف المضادة لنظام مبارك
ونطبق هذه النسب على المرشحين , التيار الأخواني له العوا وابو الفتوح والشاطر وبالتالي 36 الأخوان بدلا أن تكون لواحد منهم أصبحت تقسم على ثلاثة على الأقل يعنى لكل واحد منهم 12 %بدلا من 36 %مضمونة وبالتالي مال الميزان نحو السلفي الذي يتقدم بمرشح واحد وله 26 % وإقترب من نسبة النظام والتي ستكون بكاملها لعمر سليمان إن تقدم للترشيح أو أحمد شفيق لو بقى مرشحا بدون سليمان علاوة على من غير رأيه في الأخوان والسلف والثورة وعاد للنظام , كما أن مجموعة الليبراليين فقدت البرادعي لغاية الآن مما سيجعل أصواتها 29 % تتجه شمالا وغربا وجنوبا وشمالا وأغلبها لعمرو موسى لعلاقته مع الغرب , إذن من هذه الحسبة البسيطة نقول أن الشاطر دخل ليفقد الإخوان فرصة النجاح بالرئاسة وليس كما يتوهم البعض , وأن النجاح سيكون في الطرف المقابل والذي قد يكون متفق عليه ولسوف نتدارس الرؤيا عن إسمه فور إعلان القائمة النهائية

اسماعيل الناطور
04-02-2012, 09:07 PM
ونكمل الحسبة لنقول أن دخول عمر سليمان كمرشح رئاسي سيكون له نفس النتائج السلبية على أصوات النظام السابق والتي أحدثها الشاطر على أصوات الأخوان وستنقسم الأصوات بين احمد شفيق وعمر سليمان , لذلك من المفيد عدم دخول عمر سليمان الترشيح لبقاء أحمد شفيق محتفظا بكل أصوات النظام السابق وكذلك لأن فرصة أحمد شفيق في جمع أصوات من مؤيدي الحركات التي لا تحبذ التيار الديني هي أكبر من عمر سليمان الذي كان نائبا لمبارك , وربما أن يكون ذلك مانعا للكثير من التصويت له , وطبعا نقول ذلك على عينة الأصوات التي ذكرناها سابقا وليس عما يحدث من صفقات والتي لا زالت في علم علام النيات والغيب , لأن مجرد دخول شفيق وسليمان الترشيح معا هو دفع لعمرو موسى للمقدمة

ولكن من الغباء أن نظن أن خيرت الشاطر قد رشح نفسه بدون دراسة وخاصة أن هذا قرار جماعة تمارس العمل من عشرات السنين , إذن الخسارة المنتظرة لها مبرراتها المنطقية والغير منطقية ...
قالوا صفقة البرلمان مقابل الرئاسة وخروج الشاطر من السجن بشروط إنسحاب الأخوان من إئتلاف الثورة والميدان
هنا قد يكون شيئ مقبول فالترشيح يدمر فرص النجاح العوا وابو الفتوح المتمردين على الجماعة وبالتالي تتحق معادلة البرلمان مقابل الرئاسة
قالوا أن الثورة لم تكتمل بعد ولابد من ثورة ثانية حماس على فتح ومثلها أخوان على الجيش
وهذا قد يكون مقبول إذا كان الهدف الطعن في نزاهة الإنتخابات بعد ذلك وإحداث الفوضى اللازمة لتنصيب جرباتشوف المصري وتقسيم مصر
قالوا أن الغيرة والتأديب والشخصنة بين قيادات الجماعة واردة فهم بشر مثلنا وكل ما عندنا عندهم لذلك يجب أن يسقط ابو الفتوح
وهذا قد يكون مقبول لأن نجاحه يعني إقصاء الآخرين في الجماعة والذين تمرد عليهم وعادوه وعاداهم
وقالوا وقلنا وتبقى إحتمالات ستموت قريبا وتبرز حقيقة واحدة ...شهر يونيو شهر سيئ الذكر في تاريخ مصر

اسماعيل الناطور
04-02-2012, 09:44 PM
ونكمل الحسبة لنقول أن دخول عمر سليمان كمرشح رئاسي سيكون له نفس النتائج السلبية على أصوات النظام السابق والتي أحدثها الشاطر على أصوات الأخوان وستنقسم الأصوات بين احمد شفيق وعمر سليمان , لذلك من المفيد عدم دخول عمر سليمان الترشيح لبقاء أحمد شفيق محتفظا بكل أصوات النظام السابق وكذلك لأن فرصة أحمد شفيق في جمع أصوات من مؤيدي الحركات التي لا تحبذ التيار الديني هي أكبر من عمر سليمان الذي كان نائبا لمبارك , وربما أن يكون ذلك مانعا للكثير من التصويت له , وطبعا نقول ذلك على عينة الأصوات التي ذكرناها سابقا وليس عما يحدث من صفقات والتي لا زالت في علم علام النيات والغيب , لأن مجرد دخول شفيق وسليمان الترشيح معا هو دفع لعمرو موسى للمقدمة
وجدنا هذه الدراسة في الأهرام ويبدو إننا في الطريق المرسوم , فهناك دعوة للتصويت لعمرو موسى
نشرت صحيفة (الأهرام) الاثنين نتائج الاستطلاع الذي أجراه مركز الأهرام للدراسات السياسية والاستراتيجية والذي أوضح أن موسى يأتي في المقدمة بحصوله على نسبة تأييد وصلت إلى 31,5% بينما حصل على نسبة 22,7% أبو إسماعيل الذي أثار حالة من الجدل في الشارع المصري مؤخرا مع الانتشار الواسع النطاق للدعاية الانتخابية الخاصة به وما أثير أيضا عن حمل أمه الراحلة الجنسية الأمريكية، وهو ما يعني قانونا أنه لن يتم قبول ترشحه.
وجاء في المرتبة الثالثة الفريق أحمد شفيق آخر رئيس للوزراء في عهد الرئيس السابق حسني مبارك بنسبة 10,2% ثم عمر سليمان نائب مبارك بنسبة 9,3%، ويعاني الرجلان من التصاق ماضيهما بالنظام السابق واستعانة مبارك بهما وقت الثورة لإنقاذ نظامه.
ويلي ذلك عضو مكتب الاشاد السابق للاخوان المسلمين الدكتور عبد المنعم أبو الفتوح بنسبة 8,3% فالناصري حمدين صباحي بنسبة 4,9%، وهؤلاء هم المرشحون الستة الذين يتقدمون السباق الرئاسي.
وشمل الاستطلاع 1200 شخص من محافظات مصرية مختلفة في الفترة من 25 - 29 آذار/ مارس الماضي.
وذكرت الصحيفة أن خيرت الشاطر الذي أعلنت جماعة الإخوان المسلمين ترشيحه للرئاسة بعد انتهاء الاستطلاع بيومين لم يحصل على نسبة تؤهله للظهور.
وعبر 94,5% من العينة عن نيتهم التصويت في انتخابات الرئاسة القادمة. وأظهر المواطنون تفضيلهم للمرشح المستقل بنسبة كبيرة وصلت إلى 78,6%، فيما فضلت النسبة الباقية وقدرها 21,4% مرشحا منتميا حزبيا.
وبينت النتائج أن القسم الأكبر من المواطنين ونسبتهم 95,4% يفضلون أن تشمل اختصاصات الرئيس الشئون الداخلية والخارجية، بما يشير إلي أن المواطنين في مصر يفضلون النظام الرئاسي.
وقالت الصحيفة إنها ستوالي نشر الاستطلاعات التي سيكون لها أهمية كبيرة في تقرير سير المنافسة الرئاسية مع إعلان القائمة النهائية للمرشحين، والتي قد يختفي منها بعض المرشحين الواردين في هذا التحليل.

اسماعيل الناطور
04-03-2012, 05:54 PM
أحييك أحييك أستاذ الناطور لأنك قرأت على البعد المشهد السياسي



بعمق وحنكة وعبرت عما يردده الشارع المصري الآن من خلال هتافات ترفض
حكم الإخوان ..
أتفق مع حضرتك فيما ذهبت إليه فهذا البرلمان سيحل بحكم قضائي
من الدستورية العليا بسبب عدم التكافؤ ـ وقد حدث الترشح للانتخابات
على القوائم والمقاعد الفردية ــ كما حدث وسبق أن حُلت برلمانات سابقة
وإن حدث وأُعيدت الانتخابات فلن يتكرر برلمان 2011
أحييك أيها القدير ،،،
تقديري واحترامي












ماجي


ولسوف أذكر لك قصة من الواقع , لأن القصة قد تكون مناسبة معك أنت بالذات على خلفية ما كان بيننا من شد في تناول القضايا الإجتماعية , فكان رأيي أن الإقتراب من بعض المواضيع الحساسة ولو حدتث فعلا هو عملية تساهم في نشرها وليس خمدها في مجتمع لا زال غير محصن , وكان رأيك أن كل القضايا الإجتماعية يجب تناولها دون التغطية عليها تحت أي مبرر , القصة تشبه ما كان بينك وبيني , فقبل إنتخابات فتح حماس كنت مع المقاومة مع حماس في نظرتها للفساد في الإدارة وفي نظرتها لإستراتيجية المقاومة مع العدو بدون الإلتفات لفتن المفاوضات , وعند الإنتخابات وجدني البعض محذرا لا تنتخبوا حماس , بل قمت بالحديث مع كل قريب وصديق لا تنتخبوا حماس , فكان أو وقع الصدام في الرأي كما حدث معك , ومهما شرحت لم يستمع لي أحد , رغم أن الآن كثيرا منهم فهموا أن إنتخاب حماس للسلطة هو إختيار خاطئ , لأن من يحمل الدين عليه أن ينزهه نفسه , والسياسة والسلطة فيها من الكذب والغش ما يفقد الدين نزاهته , وبالتالي سوف يسقط بعد فترة من الحكم كل من يرفع شعارا دينيا , وبهذا يكون السياسي الذي يسير تحت يافطة الدين مساهما في قتل هيبة الدين وفرصة إدارته للمعارك النهائية بين الحق والباطل , المهم التجربة بين فتح وحماس أعطت نموذجا لحكم من يرفع الدين ويقع تحت ضغط الواقع , فوجدنا كل ما كانت حماس المقاومة تدين فيه فتح السلطة من هدنة مع العدو ومن إجتماعات ومعاملات إقتصادية والخضوع لمنطق القوة هو ما تفعله هي نفسها الآن , وكأن ما تغير هو لون العلم , وطبعا الخاسر الأكبر الشعب الذي أتاح لإسرائيل محاصرة غزة بحجة أن حماس تدعم الإرهاب , وفي مصر الموضوع يتشابه أي حكم ديني في مصر سيخضع للواقع العالمي , بينما الواقع العالمي سيجد أكثر من مبرر لحصار مصر تحت اليافطو الدينية تحت حجج الاسلام والإرهاب وإضطهاد الأقليات وحقوق الإنسان , ولاحظوا ما يحدث الآن من تمهيد فرنسي التي بدأت تتكلم عن القرضاوي الإرهابي والذي هو من جلب الناتو إلى ليبيا ويحاول في غيرها , لذلك عندما نتكلم عن الغباء والذكاء والمؤامرة يعتقد البعض إنها كلام لا مبرر له , للأسف لا نريد أن نتعلم إلا من تجاربنا وهي صيغة الحمقى الذين لا يتعلمون من تجارب الغير وينتظرون الوقوع في الحفرة ليتعلموا بعدها كيفية الخروج من الحفر , هذا إذا إستطاعوا بعد الوقوع وما حصل بهم من كسور , لذلك تجد أن حماس ترفض أي إنتخابات جديدة بسبب علمها الأكيد إنها لن تنجح أبدا فالشعب عاش التجربة ولن يعيدها , وهنا نحاول أن نقول لأهل مصر , قد تكون هذه آخر إنتخابات في مصر لو فشلت إدارة الإخوان , وأعتقد أن الفشل قادم من عدة مصادر , فلا أحد في العالم يهمه نجاح دولة إسلامية لا زالت تعتمد في شريان حياتها على المعونات والسياحة والصادرات الخارجية , تريد أن تنجح دينا فعليك أن تفترض الحصار , فهل مصر قادرة على ذلك ؟ وإن إستطاعت فهل هناك الزعيم أو المجموعة التي تريد ذلك ؟....أترك الأسئلة كالعادة لمن يهتم

اسماعيل الناطور
04-11-2012, 11:34 PM
يجب تغيير إسم مجلس الشعب المصري إلى إسم مجلس غوار , وطبعا معروف الممثل السوري دريد لحام بشخصية غوار وعبارته الشهيرة (( حارة من كل إيد له )) بمعنى حارة القوي الذي يفرض ما يشاء وقت ما يشاء على سكان الحارة , فلقد كان مجلس الشعب المصري إيام السادات هو مجلس السادات والمصفق لما يريده السادات , فكانت زيارته لإسرائيل تاريخية وتستحق التصفيق رغم أن الشعب كان لا يريد ذلك , وكان مجلس الشعب المصري أيام مبارك هو مجلس الحزب الوطني بالتفصيل والقياس والرفع والوضع وإللي مش عاجبه من الشعب يشرب من الترع , والآن وفي عصر الإخوان , فمجلس الشعب المصري إتضح إنه مجلس الإخوان ....تفصيل وقلع ومنع ...وإللي مش عاجبه يشرب البحر .....أعتقد أن هذه المرة سيشرب من السراب من إعتقدوا أن من أطلقوا عليهم فلول هو فلول فقط وليس قوة أقوى بكثير من المراحل من الإخوان ....وأن زمن الصوت العالي وهتافات الميادين قد أصبحت لا تخيف أحدا , فالحرب الإعلامية والتي أطلقوا عليها ثورات نجحت لإنها لم تكن متوقعة عند البعض فأخذتهم الصدمة وإنهاروا سريعا ,,,,أما الآن فقد إتضح للكثير أن صراخ الميادين إن لم يكن مؤيدا من الشعب حقيقة هو هبل وعبط والقوة لن ترحم المهاويس جمع مهوس إن كانت صحيحة لغويا

اسماعيل الناطور
04-12-2012, 12:26 AM
ولكن من الغباء أن نظن أن خيرت الشاطر قد رشح نفسه بدون دراسة وخاصة أن هذا قرار جماعة تمارس العمل من عشرات السنين , إذن الخسارة المنتظرة لها مبرراتها المنطقية والغير منطقية ...
قالوا صفقة البرلمان مقابل الرئاسة وخروج الشاطر من السجن بشروط إنسحاب الأخوان من إئتلاف الثورة والميدان
هنا قد يكون شيئ مقبول فالترشيح يدمر فرص النجاح العوا وابو الفتوح المتمردين على الجماعة وبالتالي تتحق معادلة البرلمان مقابل الرئاسة
قالوا أن الثورة لم تكتمل بعد ولابد من ثورة ثانية حماس على فتح ومثلها أخوان على الجيش
وهذا قد يكون مقبول إذا كان الهدف الطعن في نزاهة الإنتخابات بعد ذلك وإحداث الفوضى اللازمة لتنصيب جرباتشوف المصري وتقسيم مصر
قالوا أن الغيرة والتأديب والشخصنة بين قيادات الجماعة واردة فهم بشر مثلنا وكل ما عندنا عندهم لذلك يجب أن يسقط ابو الفتوح
وهذا قد يكون مقبول لأن نجاحه يعني إقصاء الآخرين في الجماعة والذين تمرد عليهم وعادوه وعاداهم
وقالوا وقلنا وتبقى إحتمالات ستموت قريبا وتبرز حقيقة واحدة ...شهر يونيو شهر سيئ الذكر في تاريخ مصر
عمر سليمان قد دخل السباق فعلا, والغير عاقل الذي يفترض أن رجلا كان مديرا لجهاز مخابرات عريق ولعشرات السنين قد دخل السباق لأن عدة الآف من المصريين قد خرجوا العباسية هاتفيين له , المفترض أن الرجل لديه كل الخيوط والمعلومات المحلية والدولية , والمفترض إنه رجل صفقات ومعلومات , والمفترض أن الرجل قد رأى ما حدث للرؤساء مبارك والقذافي وزين , والمفترض أن الرجل يعلم تماما مقدار وقوة خصمه من الإخوان وغيرهم , والمفترض أن الرجل قد ضمن الفوز قبل الترشيح وإلا كان لا يحق له أن يقود جهاز المخابرات بجناحيه المدني والعسكري , أعتقد أن القوى الدولية أرادت لمصر سيناريو جديد لا يتطابق مع السيناريو الليبي والفلسطيني وإلا فإن أي حكم يتخذ من القرآن دستورا , فإن القرآن لا يمكن التلاعب به وهو كفيل بإسقاط أي تافه يقف تحت علمه ليغش الناس به , وحيث أن تيار الفوضى قد اتخذ من الدين شعارا وهو لا يعمل به قد سقط , وبالتالي سقطت أحقيته في الفرصة حتى لمن كانوا وراءه بالتخطيط والمال .....
وصدق من قال البرلمان للإخوان والرئيس لمن ترضى عنه الأمريكان

اسماعيل الناطور
04-12-2012, 08:42 AM
قال جورج إسحاق،أحد مؤسسى حزب «الثورة»، الذى دعا إلى تأسيسه الدكتور محمد البرادعى، المدير السابق للوكالة الدولية للطاقة الذرية، إن الحزب من المقرر أن يكون لديه 5 وكلاء مؤسسين، منهم امرأة وسيناوي ومسلم وقبطى لم يتم تحديد أسمائهم حتى الآن، إلى جانب الدكتور محمد البرادعى بهدف أن يعبر الحزب عن جميع فئات المجتمع، مشيرا إلى أنه سيتم إعلان البيان التأسيسي للحزب نهاية الأسبوع المقبل وستحدد الأسس التي سيقوم عليها، الحزب وفي مقدمتها العدالة الاجتماعية.

وقال أحمد عيد، أحد شباب الثورة المؤسسين للحزب، إنه تم تحديد 3 لجان داخل الحزب، الأولى تختص بإدارة الحوار حول الأسس التى سيقوم عليها، والمناقشات بين أعضائه المؤسسين، والثانية تحدد المواقف الرئيسية للحزب من القضايا الحيوية على الساحة السياسية، والثالثة تضع خطة التحركات لاتخاذ الخطوات التنفيذية لإعلان الحزب، أولاها البدء فى جمع التوكيلات.

اسماعيل الناطور
04-12-2012, 03:06 PM
أستغرب أحيانا أخي إسماعيل من سلوك بوصلة السياسة في مصر ، حدث أمران غريبان ، تراجع الإخوان عن وعدهم بعدم الترشح للرئاسة ودفعهم بمرشح إحتياطي آخر ثم ترشح عمر سليمان ومهاجمته للأخوان المسلمين ، أمران سوف يؤديا إلى ترجيح كفة عمرو موسى ، وصحيح أن المشهد الضبابي الآن لا يسمح بتوقع فرص موسى جيدا ، لكن على الأغلب سترتفع فرصه بشكل أكبر مع الزمن خاصة إذا ما تم الترويج له على أنه وسط بين الأثنين وتعاون معه باقي المرشحين من غير المتصارعين حاليا ، للأسف يبدو أن الأساليب السياسية البسيطة قادرة على النجاح في مصر بشكل أكبر مما كان متوقعا
المشهد الضبابي مشهد سينمائي وليس مشهدا واقعيا ,
فشركة الإنتاج العالمية للافلام الجماهيرية أصبحت هوليودية الإسم وحجم التمويل ,
وأبطال المشهد أصبحوا معروفي القدرات والتاريخ
والمخرج أصبح يلعب في النور ويحاول إطالة الحلقات لإثارة ملل الجماهير تمهيدا للصدمة ,
والنهاية وإن إبتعدت لإحداث الملل والصدمة إلا أن الجمهور كل حسب قدرته على إختراق عقل المخرج والذي لم يكن موفقا في إحداث الملل تمهيدا للصدمة ,
لذلك قد لا يجد الكثير منا ( الجمهور ) متعة النهاية
وسنهتم فقط في متعة تقدير نوعية الجوائز والتي سيقدمها للفائز ((( مجلس التوافق الدولي )))

اسماعيل الناطور
04-13-2012, 01:51 AM
عنواننا كان
مصر تنتخب الثورة أم الفوضى
واليوم
هتافات ميدان التحرير ....الشعب يريد حازم ابو اسماعيل
هتافات إمام مقر الترشيح تقوده مجموعة حمدين صباحي
هتافات ميدان رمسيس ....الشعب يريد إعدام المشير
هتافات ميدان العباسية ....الشعب يريد المشير والشعب يريد عمر سليمان
وباقي مصر بين هذا وذاك ...
فهل تختار مصر الفوضى أم الثورة ؟
إذا إختارت مصر الثورة
فعليها أن تختار
محمد سليم العوا
أو عمر سليمان
رئيسا لمصر
وإذا إختارت مصر الفوضى
فإن واحدا من الواحد والعشرين مرشح الباقيين
سيتم دفعه للرئاسة

اسماعيل الناطور
04-13-2012, 11:19 AM
تظاهرات اليوم يمكن إطلاق عليها إسم ....((ألفية الذقون للضحك على الذقون ))

تجدر الإشارة إلى أن ما يطلق عليه مليوينة حماية الثورة اليوم شهدت جدلا كبيرا بين القوى الاسلامية والثورية حول المشاركة فيها، فقد أعلنت العديد من الأحزاب والقوى مشاركتها فيها ومن أبرزهم جماعة الاخوان المسلمين، وحزب الحرية والعدالة، والدعوة السلفية، وحزب النور، وحزب الأصالة، والجماعة الاسلامية، وحزب البناء والتنمية، وحزب الوسط، في الوقت الذي عارضها البعض الآخر وفى مقدمتهم حزب المصريين الاحرار، وحزب التجمع، وائتلاف شباب الثورة، وحركة 6 أبريل "أحمد ماهر"، واتحاد شباب الثورة، والحزب الناصرى، وحركة 6 أبريل "الجبهة الديمقراطية" والجمعية الوطنية للتغيير.
وواضح هنا أن إنقسام التظاهريييييين كان بسبب الكراسي وليس معاداة النظام السابق .....

اسماعيل الناطور
04-14-2012, 03:47 PM
حوار مهم جدا مع عمر سليمان على الرابط
www1.youm7.com/news.asp?newsid=652661&secid=12

نقتبس من الحوار ما قاله عن 25 يناير .

هذا الموضوع كان معلوما لدينا من عام 2007 بأن هناك تخطيطا لتغيير الأنظمة العربية بواسطة الحشد الجماهيرى، وهذا البرنامج تم تنفيذه مع الشباب لتدريبهم على مقاومة السلطات وإسقاط الأنظمة فى إطار خطة الفوضى الخلاقة، وكنا نتابع كل شىء فى هذا المقام، وتحركات أمريكا لتنفيذ الفوضى الخلاقة فى مصر، وكنا نتوقع كل ما جرى وكانت تقديراتنا أنها مظاهرة كبيرة، ومرت المظاهرات يوم 25 بلا مواجهة وبلا دم سوى حالة واحدة فى السويس، ولكن عندما دخلت التيارات الدينية وسيطرت على هذه الحشود تغير الموقف.

اذن كانت ثورة مصر بيد الله سبحانه
هم ارادوها ماسونية و لكن الله أرادها غير ذلك
أعتقد ان عمر سليمان يؤيد وجهة نظركم يا أ اسماعيل في
( ثورة الحمير )

فهل لذلك ترى أن ترشيحه إنقاذا لمصر رغم فشله في عدم التنبؤ بحجم الثورة ؟


بالتأكيد ما قاله عمر سليمان يستحق الدراسة من كل مواطن مصري يخاف على وطنه , وبالتأكيد أشعر براحة نفسية لصحة ما توقعت , ولكن مصر غالية لمن يعرف موقعها التاريخي والجغرافي والاسلامي والحضاري , لذلك شرحت سبب ترشيحي لعمر سليمان بعد محمد سليم العوا لأن الإختيار وقد حسمه القدر من ثلاث وعشرين شخصية مصرية يجب أن يختار الشعب منها رئيسا , وكم كان بودي شخصا آخر في مقام صلاح الدين أو قطز أو عبد الناصر أو حتى رمسيس ......ولكن الأمر فيما هو معروض وليس بما نتمنى ....وخوفا على مصر وفقط مصر كان إختيار المفكر الاسلامي الذي لا يتبع ولا مدان لحزب أو جمعية أو تمويل بعكس كل الآخرين والذين ولاءهم لأحزابهم أو جمعيات التمويل والصفقات أو الضعفاء , فكان يجب القفز عليهم لإختيار القوي ولو على رأسه بطحة ....أتمنى أن أكون قد شرحت نيتي ...الخير لمصر وخمد الفتنة من الماسون والحمير والأغبياء والمفغلين الذين لا يبصرون

اسماعيل الناطور
04-15-2012, 09:25 AM
يقول ديفيد ورمر وهو يصف عملائه من الإعلاميين العرب
لا بد أن نجد إسطبلا من الإعلاميين العرب يشبه سفينة نوح
الأحصنة في هذا الإسطبل وظيفتهم أن يقولوا دائما أن سوريا وإيران هما المشكلة
أما الحمير فهم من يصدقوننا إننا نريد الديمقراطية
أما حديقة الخنازير الذين يقتاتون على فضلاتنا فمهمتهم كلما أعددنا مؤامرة أن يقولوا أين هي المؤامرة ؟

اسماعيل الناطور
04-27-2012, 02:01 PM
إخترت أن أكون متفرجا خلال الأيام الماضية
فالصمت أحيانا أكثر تعبيرا عندما يفقد المستمع القدرة على التمييز بين الأصوات فيختلط الجميل مع النشاز ,
والصمت أقدر إتاحة لفرص الإستيعاب والتفكير للعقل السليم .
والصمت هبة من هبات الصبر على الأذى وخاصة إذا كانت من مريض نفسي أو مريض عقلي أو ما بينهما ممن لا أجد له إسما .
الفوضى في العالم العربي والناتجة عن ضياع الوعي لدرجة المرض ,
لدرجة أن أحدا لا يتوافق مع غيره في أقل رابط يحمي المجموعة وهو رابط وحدة العدو ,
العدو التقليدي والتاريخي أصبح الأخ الأكبر والمساند الأعظم ,
والأخ الشقيق أصبحت عداوته كأسهم البورصة إرتفاعا وإنخفاضا ويحددها خبر ضائع أو كاذب من فضائية أو ملتقى ,
والجار أصبح من أهل الدار , فلا تأشيرة ولا حياء ويفتي ويرغي ويزبد وربما يطلب أهل الدار للفراش ,
وما أطلقوا عليه الشعب ...أصبح حصان وربما أقل ...يمتطيه فارس أو جبان ...المهم أن يكون لديه مال ليشتري لجام ,
لذلك عدنا إلى موضوعنا ...في بيتنا مريض نفسي ....لنتابع من خلاله بعض ما إستجد من أمراض


http://www.almolltaqa.com/ib/showthread.php?24779-في-بيتنا-مريض-نفسي

اسماعيل الناطور
05-07-2012, 10:25 PM
بعد الإستبعادات والتي ما زالت تحت الطعون .....نعود إلى مشاركتنا القديمة والقديمة وجدا .....نقول بقى في السباق أربعة من مجموعة وائل غنيم ومن وراءه
عمرو موسى--ابو الفتوح - -حمدين صباحي -والبسطويسي


يوم بعد يوم, بل يمكن القول ساعة بعد ساعة, يقترب المواطن المصري من تحديد مرشحه الانتخابي لرئاسة مصر, ويمكن القول أن الرئاسة انحصرت بين مشروعين, وكل منهما يحاول جذب مصر الثورة الحقيقية والتي خرجت بكاملها في 25 يناير ضد فساد حسني مبارك وليس لإسقاط مصر تاريخ وجغرافيا كما أراد لها من خططوا إشعال عود الثقاب, هناك مشروع مصري خالص ويستند على مشروع مصر العربية بدون أي ارتباطات فكرية خارجية وإصلاح ما فسد ويقوده المجلس العسكري المصري ممثلا في أحمد شفيق , ومشروع آخر يمثله مجموعة وائل غنيم وهو مشروع يقوده الخارج ضمن مخطط يهدف إلى تغيير صورة العالم وليس مصر فقط , إذن المواطن المصري بين أحمد شفيق من جهة وبين عبد المنعم أبو الفتوح وعمرو موسى ومحمد مرسي والبسطويسي في الجهة المقابلة والتي تتبنى ما أطلقوا عليه مشروع النهضة , المال الانتخابي سيدخل كثيرا من الجيوب , بل أن اعتقادي الشخصي أن الصوت الانتخابي سيكون مائل للون الأخضر , وكلما زاد عدد الدولارات زاد اللون شدة , فالواضح أن معركة الرئاسة هي معركة حياة أو موت بين مشروعين لا يلتقيان طالما أن الجيش المصري هو سيد قراره , لذلك كانت معركة هدم الجيش المصري معركة شاهدنا فصولها ليس من الآن بل في الحقيقة منذ لحظة اغتيال الرئيس السادات على يد جنوده وفي يوم نصره لدرجة أن قرار منع ظهور الجيش إمام الشعب قد اتخذه أحدهم من تلك اللحظة , فلا احتفالات ولا استعراضات شعبية للجيش , إلى أن يأتي جيل من الشباب لا يعرف عن جيشه شيئا ....وأعتقد أن هذا الجيل قد تم إيجاده الآن وهو الجيل الذي سمح لنفسه أن يرفع شعار أو يتقبل كلمة ...عسكر ...بدلا من جيش

غازية منصور الغجري
05-08-2012, 03:40 AM
اتابعك باحترام عزيزي
دامت سوريا بعز ونصر وانتصار .

:s20:

اسماعيل الناطور
05-08-2012, 11:54 PM
أما حمدين صباحي فهو ناصري يتبنى الفكر العلماني اللليبرالي ويعادي المشروع الإسلامي
الأخ محمد ...حمدين صباحي وعبد المنعم ابو الفتوح حملتان رئاسيتان متطابقتان وقد أعلن هذا رسميا كل منهما على الفضائيات وقد إتفق الإثنان أن الحملة التي تسقط في الجولة الأولى تساند الأخرى في الجولة الثانية وأن الناجح منهما يتخذ من الآخر نائبا له , وهذا يؤكد ما أطلقته ومنذ زمن على مجموعة من المرشحين بأنهم مجموعة وائل غنيم والتي كان يتصدرها البرادعي والذي خرج من السباق لأن الحملة الشعبية وتاريخه الأسود وأخطاءه في فرض نفسه رئيسا للوزراء ومن الميدان كانت أسبابا لثقته بالفشل والآن يتصدر تلك المجموعة أربعة آخرين وهم عمرو موسى والبسطويسي وحمدين صباحي وعبد المنعم ابو الفتوح , ويبدو أن إختيار البرادعي ورجاله لإعلان المساندة لحمدين بدلا من عبد المنعم كان بسبب أخطاء وكذب رجال ابو اسماعيل وأخطاء الأخوان في نكث الوعود وتقديم الشاطر ومرسي علاوة على مناقشات مجلس الشعب وعدم وصولها لقلب المواطن العادي والذي ساند الثورة لمنع الفساد وليس لإستبدالها بالفوضى والفساد من نوع آخر
....حمدين صباحي وكل المرشحين ليس لديهم مشروع إسلامي حقيقي ...فهناك فرق بين مشروع الإسلام السياسي مشروع الإخوان والذي أطلقوا عليه مشروع النهضة وهو مشروع مستورد ولم ينطلق من عقول مصرية , المثقف حتى لا يقع في حفرة الاعلام يجب عليه قراءة ما لا تذكره تلك الوسائل ومن ضمنها مشروع النهضة الذي يتغنى به الشاطر ومرسي وعبد المنعم وحمدين ....ولاحظ أن أول من أعلن تأييده لحمدين هو مؤيدي حملة البرادعي في أوروبا

سلسلة نقاش مرشح رئاسي ( 6) حمدين صباحي (http://almolltaqa.com/ib/showthread.php?96665-سلسلة-نقاش-مرشح-رئاسي-(-6)-حمدين-صباحي)

اسماعيل الناطور
05-08-2012, 11:56 PM
رغم أن مصر أكبر من كل مرشحي الرئاسة دون إستثناء
إلا أن وصندوق الإنتخابات هو الحكم الآن ...ولابد من الإختيار
أقول ....لو كان لي حق التصويت ...لمنحت صوتي إلى
....محمد سليم العوا ...ولكن يبدو أن فرص الرجل قليلة , فهناك مشروعين لا ثالث لهما
مشروع البرادعي أو من حل محله
ومشروع المجلس العسكري أو من يمثله
سلسلة نقاش مرشح رئاسي(5) محمد سليم العوا (http://almolltaqa.com/ib/showthread.php?96662-سلسلة-نقاش-مرشح-رئاسي(5)-محمد-سليم-العوا)

اسماعيل الناطور
05-10-2012, 01:05 PM
اتابعك باحترام عزيزي
دامت سوريا بعز ونصر وانتصار .

:s20:
عندما تبدأ المراجعة
تبدأ من النخبة المستقلة والقلم النابع من الرأي الشخصي
وأعتقد أن المراجعة بدأت ولسوف يشتد عودها كلما تأكد البعض من الحفر الكثيرة التي كانت مغطاة بالزهور السامة
هو فضاء لكلّ من يشعر أنّ الثورات العربيّة قد استغفلته واستهبلته وسرقت منه شيئا ثمينا قد لا يمكنه استرداده يوما ...هو فضاء لكل مصدوم في ثورة قيل أنها لاسترداد الكرامة فسرقت من آدميتنا كلّ كرامة...لكل مصدوم في ثورة البحث عن الحرية التي تأكد لدينا أخيرا أنها سرقت نور الحرية ...وسرقت الأمان وسرقت الأمجاد وسرقت الفكر وسرقت الكحل من العين ...ولم تتردد حتى في سرقة دماء الشهداء...كل من يجد نفسه مثلي يجتر مرارة ثورة لم ير منها سوى القهر والاحباط والخوف من غد مظلم أظلم أسود من قرن الخروب فليفضفض هنا ... للفضفضة مفعول السحر أحيانا ...




ليس هناك أحد قام بإستغفالك أو إستغفال غيرك , فالمجرم هو المثقف نفسه الذي إرتضى سرقة الوعي منه وفي وضح النهار , تحت شعارات لم يحاول أن يجتهد ويقوم بتفسيرها ...وخاصة شعار الشعب يريد إسقاط النظام , فما هو النظام الذي كان يقصده البعض , هل نظام الحاكم ؟ أم نظام المجتمع ؟
هل أحدا منكم فكر أن يوجه السهام للشخصية العربية ؟
وهل فكر أحدكم في أن يتجرأ ويقول ...ربما العيب فيكم وليس في من يتولى أمركم ؟
وعلى سبيل المثال لنفكر وبصوت عال ....هل مثلا كان حسني مبارك فاسدا قبل أن يتولى الحكم ؟ أم أن الشخصية المصرية قد أدت به أو سمحت لشيطانه أن ينطلق ؟
لو عدنا للتاريخ وقلنا ...
لماذا بنى المصريون الأهرام ؟ ....هل بنوه من أجل أن يكون عنوان حضارة أم إنه تلبية لأمر الحاكم في بناء مقبرة يستريح فيها بعد الموت
لماذا شق المصريون قناة السويس ؟...هل من أجل أن يكون ممرا بحريا مهما لسعادة شعوب العالم أم إنه تلبية لأمر الحاكم ومنفعة للمستعمر
لماذا حاربوا في 67 وكانت الهزيمة ؟ ....هل من أجل فلسطين أو سوريا أو لأن عبد الناصر قرر ذلك بعد أن وضعه أحدهم في موقف حرج
لماذا حاربوا في أكتوبر وإنتصروا وحملوا السادات على الأعناق ؟ ولماذا أيضا حملوه على الأعناق بعد كامب ديفيد والذي يتبرأ منها الآن كل كذاب ومنافق
لماذا كان الموقف من حصار غزة معاكس لكل القيم وسكت الشعب على ذلك ؟ هل لأن حسني أراد ذلك أم كانت قناعة من الشعب
إن الشخصية العربية شخصية ضعيفة غير مثقفة وربما تصل إلى السذاجة والطاعة العمياء لكل قوي , وأعتقد أن حسني مبارك على سبيل المثال ,كان موظفا مثاليا ....وقائدا عسكريا تدرج في القيادة حتى قاد الحروب وأهم نصر لمصر والعرب , ولكنه وجد أمامه شعب يصفق له وبعضهم يلعن عبد الناصر الذي بكى عليه , وبعضهم قتل السادات الذي حمله على الأعناق في حسناته ومصائبه , وجد البعض يصفق له في كل ما يقول ...فضاع الرجل وأهمل الوظيفة وربما حدث نفسه بما هو أكثر....
ونعود إلى قول الله وهو القول الفصل ....(( إن الله لايغير ما بقوم حتى يغيروا ما بأنفسهم ))...

اسماعيل الناطور
05-10-2012, 02:27 PM
و الحقيقة المغيّبة و الّتي لا يهتدي اليها العرب بسبب الجهل و الأمّية..أنّ هذا الغرب الاستعماري الصّهيوني الراسمالي ..هو من أراد و من أعان الاسلام السّياسي ليكون في السّلطة ..و هو من قتل الثّورة ...حتّى تبقى الشّعوب العربيّة ضعيفة و فقيرة و متحاربة ...ليسهل استغلالها و سرقة ثرواتها و السّيطرة على أسواقها .



منقول عن المفكر التونسي : باركا حنبعل.

وضعنا هنا ومنذ زمن طويل موضوع بإسم نظرية تسمين العجول , والذي كان من السهل تطبيقها على الإسلام السياسي لضرب الدين الإسلامي الصحيح في وجدان وضمير الشخصية العربية الغير محصنة من الجهل والأمية , فما كان عليهم إلا تجميع العدد المناسب من الشخصيات التي تعلمت المناهج الدينية إن كانت من الكتاتيب أو الجامعات أو بالمظهر وقراءة بعض الكتب دون أن تتعلم الحياة وخبراتها وفروع العلم الأخرى والتي تعطي للإنسان حصانة من الخداع والتلاعب بعقله دون أن يدري , جمعوا تلك الشخصيات بإسم الدين وأمدوها بالمال , وخلقوا الظروف والأسباب لتكون عنوانا لأشرف وأعدل وأنقى دين عرفته البشرية , أمدوهم فأوصلوهم إلى الواجهات , تم تركوهم إمام الناس ليدرك الناس مدى الخلل الذي يعانيه الكثير منهم , فحصدوا النتيجة والتي بحثوا عنها وخططوا لها , ألا وهو ضرب الإسلام من خلال أهله , فخرج الكثير يجاهر بعداء الاسلام وليس بالاسلام السياسي الذي يقوده هؤلاء , إن الاسلام دين وحياة ودولة وديمقراطية وشورى وعفة وصدق وعطف وحنان وعدل ولم يكن يوما ذقن وكراسي ومال إنتخابي وشعارات يصرخ بها من يصلي ومن لا يعرف الصلاة

اسماعيل الناطور
05-13-2012, 08:26 AM
إني أشفق على المواطن المصري البسيط والذي هو من سيمنح للرئيس حق الرئاسة , إذ أجد أن النخبة المصرية هنا لا تستطيع أو تخاف أن تحدد مرشحها
فكيف حال المحتاج أو المقهور أو الأمي أو الغير متابع , لقد نجح حاملي لقب الإسلام من الأخوان والسلفيين في إنتخابات مجلس الشعب , لأن المواطن المصري مسلم العقيدة والوجدان , فوضع صوته مع كل من قال ...ربنا الله ...بصدق أو بسياسة ...ولكنه الآن محتار ...يقولون له ...لا تنتخب أسماء معينة وأطلقوا عليها لقب فلول وربطوها بفساد أسرة محمد علي الجديدة أسرة مبارك , رغم أن كثيرا من الفلول ترتبط في وجدان الشعب بثورة يوليو وإنجازات التعليم والصناعة والزراعة والكرامة والجيش ووحدة الوطن , لكن الغلبان ماذا يفعل ...وهو لا يجد من النخبة من يشجعه , بل يجد من نخبته إنها أكثر ضياعا وتردد .
لو كنت مصريا لبحث عن المجرب وإبتعدت عن من يريد أن يجرب بي
لو كنت مصريا لبحث عن الصادق وإبتعدت عن ما حامت حوله شبهة كذب
لو كنت مصريا لبحث عن من يرتضيه الجيش لأن هذا السبيل الوحيد للأمن ولوحدة مصر وإستقرارها
لو كنت مصريا لإنتخبت محمد سليم العوا أو أحمد شفيق لأن الإثنين صفحة واضحة يمكنك قراءة سطورها بوضوح ويتوفر فيهما نسبة عالية مما سبق

اسماعيل الناطور
05-14-2012, 11:01 PM
سؤال لمن يحاول التفكير
ما زال التلميع الإعلامي لحمدين صباحي على قدم وساق ...
فمجموعة وائل غنيم تتقدم بثلاث مرشحين
عمرو موسى وعبد المنعم ابو الفتوح وحمدين صباحي
ولكن السؤال للمتابع ...
هل الدعم الواضح والمعلن لحمدين هو لوصول حمدين صباحي للرئاسة فعلا ؟؟؟؟!!!!
أم الهدف منه سرقة أصوات التيار الناصري الكبير من أحمد شفيق لكسره من الجولة الأولي تم الإنقضاض على حمدين لصالح عبد الفتوح وعمرو موسى في جولة الإعادة ؟؟!!!!!!

أبو صالح
05-15-2012, 09:17 AM
ثورة الحمير بقلم/ اسماعيل الناطور
رئيس على وحدة ونص بقلم/ اسماعيل الناطور

سؤال لمن يحاول التفكير
ما زال التلميع الإعلامي لحمدين صباحي على قدم وساق ...
فمجموعة وائل غنيم تتقدم بثلاث مرشحين
عمرو موسى وعبد المنعم ابو الفتوح وحمدين صباحي
ولكن السؤال للمتابع ...
هل الدعم الواضح والمعلن لحمدين هو لوصول حمدين صباحي للرئاسة فعلا ؟؟؟؟!!!!
أم الهدف منه سرقة أصوات التيار الناصري الكبير من أحمد شفيق لكسره من الجولة الأولي تم الإنقضاض على حمدين لصالح عبد الفتوح وعمرو موسى في جولة الإعادة ؟؟!!!!!!
تريد اجابة على سؤالك يا اسماعيل الناطور؟
تهريج في تهريج في تهريج
من العنوان إلى المحتوى إلى الأسئلة
هذا هو كل ما ستخرج به من مواضيع اسماعيل الناطور والمتعلقة بانتفاضات أدوات العولمة ولذلك لن يعجب بها عن اقتناع بالحجة والدليل إلاّ المُهرّجين على الأقل من وجهة نظري
والسبب واضح وبسيط ابتدأه جمال عبدالناصر وتبعه في ذلك تلامذته حرفيا والحجة نظرية المؤامرة
وفي موضوع نظرية المؤامرة وبالنسبة لي هناك شيئان الأول اسمه مؤامرة والثاني اسمه نظرية المؤامرة وأنقل احدى مدخلاتي تحت العنوان والرابط التالي ومن أحب المزيد فعليه بالضغط على الرابط
ناقل الكفر ليس بكافر، ولكنّه مُثَّقَّف ببغائي، ومسبّب للفتن، لماذا؟
http://www.arabelites.com/vb/showthread.php?t=13781 (http://www.arabelites.com/vb/showthread.php?t=13781)
لأنَّه هناك مؤامرة والتي تكون لها أدّلة منطقية وموضوعيّة تثبت دور كل جهة وكيفية تحركها فيها هنا الموضوع لا لبس ولا تدليس ولا خداع فيه

نأت الآن إلى نظريّة المؤامرة والمؤمنين بها على أسس تأويليّة بعيدا عن أي دليل منطقي أو موضوعي أو علمي؟!!! وفي العادة تجدهم ممّا أطلق عليه أنا مُثَّقَّف دولة الفَلسَفَة ولاحظت أنَّ لهم نمط فكري واضح ومحدّد بغض النظر عن الدولة التي ينتمي إليها في منظومة الأمم المتحدة، تجده في العادة هو من يفتعل المؤامرة بشكل متعمد ومقصود من أجل حماية النُّخب الحَاكِمَة بالنسبة له وذلك بأن يأتي على شيء أبيض ويدعي أنّه أسود ومن ثم يصدر فتواه على اللون الأسود، ولاكتشاف الحقيقة أُنظر فقط إلى اللون هل هو أبيض أم أسود ستكتشف الخدعة
ومثال عملي على ذلك ما قامت به غازية منصور الغجري تحت العنوان والرابط التالي
لم يقدروا على ايران ولكنهم بسهولة استعبدوا تركيا ..اتفاق جوبيه – أردوغان
http://wata1.com/vb/showthread.php?p=44064#post44064
بعد مراجعة الروابط تبين أن الموضوع الفرنسي تم نشره في نفس اليوم تحت اسم ميشيل أنان في منتدى مثل هذا المنتدى؟ كما هو حال موضوع غازية منصور الغجري؟
فالسؤال المنطقي والموضوعي كيف عرفت به غازية منصور الغجري في نفس اليوم؟ وكيف تم ترجمته في نفس اليوم مع تحفظي على مفهوم كلمة ترجمة؟!!! وما علاقة غازية منصور الغجري بالشخص ميشيل أنان لكي تعرف بما ينشره في نفس اليوم؟
ومن له مصلحة أو المستفيد من تخريب العلاقة بين سوريا وتركيا؟ ومن له مصلحة أو المستفيد من تشويه صورة أردوغان؟ خصوصا وأن ألان جوبيه هو وزير خارجية فرنسا ومن المنطقي والموضوعي أن يكون الاتفاق مع وزير خارجية تركيا وليس مع رئيس الوزراء التركي أردوغان؟!!!
ولم الاتيان على اسم ايران في العنوان أو في النهاية لرفع أسهمها؟ فهل غازية منصور الغجري لها ولاء لإيران أكثر من ولاءها لسوريا أم ماذا؟
خصوصا لو انتبهنا على ما نشرته بنفسها عن الدور الذي قامت به بالتعاون مع السلطات الإيرانيّة تحت العنوان والرابط التالي
الاحواز العربية تحت السياط الفارسية
http://wata1.com/vb/showthread.php?t=8254 (http://wata1.com/vb/showthread.php?t=8254)
ما رأيكم دام فضلكم؟

أبو صالح
05-15-2012, 09:21 AM
ثورة الحمير بقلم/ اسماعيل الناطور
رئيس على وحدة ونص بقلم/ اسماعيل الناطور

سؤال لمن يحاول التفكير
ما زال التلميع الإعلامي لحمدين صباحي على قدم وساق ...
فمجموعة وائل غنيم تتقدم بثلاث مرشحين
عمرو موسى وعبد المنعم ابو الفتوح وحمدين صباحي
ولكن السؤال للمتابع ...
هل الدعم الواضح والمعلن لحمدين هو لوصول حمدين صباحي للرئاسة فعلا ؟؟؟؟!!!!
أم الهدف منه سرقة أصوات التيار الناصري الكبير من أحمد شفيق لكسره من الجولة الأولي تم الإنقضاض على حمدين لصالح عبد الفتوح وعمرو موسى في جولة الإعادة ؟؟!!!!!!
تريد اجابة على سؤالك يا اسماعيل الناطور؟
تهريج في تهريج في تهريج
من العنوان إلى المحتوى إلى الأسئلة
هذا هو كل ما ستخرج به من مواضيع اسماعيل الناطور والمتعلقة بانتفاضات أدوات العولمة ولذلك لن يعجب بها عن اقتناع بالحجة والدليل إلاّ المُهرّجين على الأقل من وجهة نظري
والسبب واضح وبسيط ابتدأه جمال عبدالناصر وتبعه في ذلك تلامذته حرفيا والحجة نظرية المؤامرة
وفي موضوع نظرية المؤامرة وبالنسبة لي هناك شيئان الأول اسمه مؤامرة والثاني اسمه نظرية المؤامرة وأنقل احدى مدخلاتي تحت العنوان والرابط التالي ومن أحب المزيد فعليه بالضغط على الرابط
ناقل الكفر ليس بكافر، ولكنّه مُثَّقَّف ببغائي، ومسبّب للفتن، لماذا؟
http://www.arabelites.com/vb/showthread.php?t=13781 (http://www.arabelites.com/vb/showthread.php?t=13781)
لأنَّه هناك مؤامرة والتي تكون لها أدّلة منطقية وموضوعيّة تثبت دور كل جهة وكيفية تحركها فيها هنا الموضوع لا لبس ولا تدليس ولا خداع فيه

نأت الآن إلى نظريّة المؤامرة والمؤمنين بها على أسس تأويليّة بعيدا عن أي دليل منطقي أو موضوعي أو علمي؟!!! وفي العادة تجدهم ممّا أطلق عليه أنا مُثَّقَّف دولة الفَلسَفَة ولاحظت أنَّ لهم نمط فكري واضح ومحدّد بغض النظر عن الدولة التي ينتمي إليها في منظومة الأمم المتحدة، تجده في العادة هو من يفتعل المؤامرة بشكل متعمد ومقصود من أجل حماية النُّخب الحَاكِمَة بالنسبة له وذلك بأن يأتي على شيء أبيض ويدعي أنّه أسود ومن ثم يصدر فتواه على اللون الأسود، ولاكتشاف الحقيقة أُنظر فقط إلى اللون هل هو أبيض أم أسود ستكتشف الخدعة
ومثال عملي على ذلك ما قامت به غازية منصور الغجري تحت العنوان والرابط التالي
لم يقدروا على ايران ولكنهم بسهولة استعبدوا تركيا ..اتفاق جوبيه – أردوغان
http://wata1.com/vb/showthread.php?p=44064#post44064
بعد مراجعة الروابط تبين أن الموضوع الفرنسي تم نشره في نفس اليوم تحت اسم ميشيل أنان في منتدى مثل هذا المنتدى؟ كما هو حال موضوع غازية منصور الغجري؟
فالسؤال المنطقي والموضوعي كيف عرفت به غازية منصور الغجري في نفس اليوم؟ وكيف تم ترجمته في نفس اليوم مع تحفظي على مفهوم كلمة ترجمة؟!!! وما علاقة غازية منصور الغجري بالشخص ميشيل أنان لكي تعرف بما ينشره في نفس اليوم؟
ومن له مصلحة أو المستفيد من تخريب العلاقة بين سوريا وتركيا؟ ومن له مصلحة أو المستفيد من تشويه صورة أردوغان؟ خصوصا وأن ألان جوبيه هو وزير خارجية فرنسا ومن المنطقي والموضوعي أن يكون الاتفاق مع وزير خارجية تركيا وليس مع رئيس الوزراء التركي أردوغان؟!!!
ولم الاتيان على اسم ايران في العنوان أو في النهاية لرفع أسهمها؟ فهل غازية منصور الغجري لها ولاء لإيران أكثر من ولاءها لسوريا أم ماذا؟
خصوصا لو انتبهنا على ما نشرته بنفسها عن الدور الذي قامت به بالتعاون مع السلطات الإيرانيّة تحت العنوان والرابط التالي
الاحواز العربية تحت السياط الفارسية
http://wata1.com/vb/showthread.php?t=8254 (http://wata1.com/vb/showthread.php?t=8254)
ما رأيكم دام فضلكم؟

اسماعيل الناطور
05-15-2012, 10:46 AM
سؤال لمن يحاول التفكير
ما زال التلميع الإعلامي لحمدين صباحي على قدم وساق ...
فمجموعة وائل غنيم تتقدم بثلاث مرشحين
عمرو موسى وعبد المنعم ابو الفتوح وحمدين صباحي
ولكن السؤال للمتابع ...
هل الدعم الواضح والمعلن لحمدين هو لوصول حمدين صباحي للرئاسة فعلا ؟؟؟؟!!!!
أم الهدف منه سرقة أصوات التيار الناصري الكبير من أحمد شفيق لكسره من الجولة الأولي تم الإنقضاض على حمدين لصالح عبد الفتوح وعمرو موسى في جولة الإعادة ؟؟!!!!!!
وهل كان ينتظر تقدم أحمد شفيق على عمرو موسى مثلاً..
إن كنت أرفض الإثنان ( عمرو ، شفيق ) ولكن ما أعتقدة أن قاعدة عمرو أكبر بكثير من شفيق .


عمرو موسى إختار بعد الثورة طريقا لا لون له ولا رائحة , فلا هو حافظ على أغنية ( بحب عمرو موسى وبكره إسرائيل ) ولا حافظ على علاقة واضحة مع التيارات الجديدة , فكان في وضع المرغوب به دوليا لمواقفه الدولية وتسهيل مهمة الناتو والأقل رغبة محليا لعدم إتخاذه مواقف ثورية علنية تؤكد تلك الأغنية ....لذلك أعتقد أن البدليل أحمد شفيق أكثر قربا من أصوات هذا التيار ....هذا ما جعل من يحصون الأنفاس أن يتقدموا بلعبة حمدين صباحي , والذي بدأ ترشيحه من البرادعي وإنتهى بمساندة وائل غنيم , رغم أن البرادعي ووائل غنيم في خانة لا يمكن تسجيلها في مركب الناصرية أو الإشتراكية ....أليس كذلك ؟.....أما عن ترشيحك لمحمد مرسي ...فأعتقد أن التابع لن يكون في وضع قيادي يقود به شعب في أهمية شعب مصر وطبعا هذا رأي أستنتجه من فوز حماس في غزة وما حدث بعدها من إنقيادها للخارج أكثر مما إنقادت للشعب الذي إنتخبها, وهذا ليس إختيارا ولكنه سطوة المال , والمال هو القائد هذا الزمان , ومشروع النهضة الذي تدعوا له جماعة الأخوان مشروع ...صنع خارج مصر ...وله أهداف ويمكن لك البحث عنه في ظلمات الشبكة فهو موجود

اسماعيل الناطور
05-15-2012, 11:22 AM
ربما كنت أتمنى من قبل أن تكون مصريا يا سيد إسماعيل ، لأنه شرف لنا أن يكون مفكر ومثقف ومحلل مثلك مصريا ، ولكني الآن لا أتمنى ذلك – مؤقتا حتى تنتهي الإنتخابات – حتى لا ترشح أحمد شفيق ، أحد ... القصر .
ومن ناحية أخرى فلا يجدر بك أن تجمع بين عالم قانوني كدكتور سليم العوا وأحمد شفيق أحد ... القصر

انتظر مقالتي أستاذ إسماعيل
أحمد شفيق مرشح معندوش دم ، واللي يرشحه ...
من ناحية الدم ...إكتشفت إنه عنده دم وفصيلة دمه ( o) ...
أما مقالتك فلا أريد إنتظارها ...فهى كهذه المشاركة لا تبحث عن المعلومة بل تبحث على قتل المعلومة
.....كل قوانين الأرض من الفطرة حتى الإسلام لا تعاقب إنسان على جرم إرتكبه غيره , وكل مرشح رئاسي أو حتى كل طالب عمل , يناقش طلبه حسب ما تحتويه بياناته من خبرات أو شهادات أو قدرات ....
وهذه أول مرة في التاريخ أجد من يحاسب أحدا تحت طائلة إنطباعات ....فهذا فلول وذاك إخوان وذاك ...وذاك ...أجد في الموضوع مهازل تستهدف عقل البسطاء ....المفروض عندما أقول ...أقبل بك هنا أو لا أقبل بك هنا أتقيد حسب بنود واضحة تخص شخصية المتقدم ...
أما قصة الفلول فهى تنطبق على كل موظف مصري يأخذ راتبا من الحكومة المصرية أيام مبارك ...
وعليه يجب أن تحرموهم من حق التصويت في الإنتخاب كما تريدوا حرمانهم من حق الترشيح , فلا ثقة في الفلول ...
وإلا أنتم عايزينهم بس ينتخبوا (يبصموا ) دون أن يكون لهم حق الترشيح مثل باقي الشعب
هؤلاء كانوا موظفين دولة ولم يكونوا موظفين في بلاط حسني وهم يشكلون أغلبية الشعب المصري
ومن أطلق لقب فلول على موظف الدولة هو إنسان أراد خديعة البسطاء

اسماعيل الناطور
05-15-2012, 11:23 AM
شكرا لك أستاذ أسماعيل
أما سبب إحجام بعض الأخوة المصريين عن قول رأيهم بصراحة
لأنه سرعان ما سيدخل أحدهم يسفه رأيه و يظهره أما بالجاهل أو العميل أو الفلولي
هكذا نحن مع الأسف
لكلٌ منا وجهة نظره الخاصة و أسبابه الخاصة و معطياته الخاصة التي يعتمد عليها
فعقولنا تتفاوت لذا فاختياراتنا تتفاوت
الموضوع أسمه
( إكتب رئيس مصر القادم )
و ليس أسمه ( سفّه و قلّل من رأي معارضك )
لذا فاتمنى حقا لكل من سيشارك في الموضوع
أن يكتب أسم من سيرشحه بشجاعة بعيدا عن تسفيه رأي الآخرين
و أؤمن بتلك المقولة
أنت حر ما لم تضر

شكرا مرة أخرى أستاذ اسماعيل






تحية لك
وتحية للأخت جلاديولس
فكل منكما سجلت مرشحها بشجاعة فاقت الرجال

أبو صالح
05-15-2012, 11:35 AM
ثورة الحمير بقلم/ اسماعيل الناطور
رئيس على واحدة ونص بقلم/ اسماعيل الناطور
عمرو موسى إختار بعد الثورة طريقا لا لون له ولا رائحة , فلا هو حافظ على أغنية ( بحب عمرو موسى وبكره إسرائيل ) ولا حافظ على علاقة واضحة مع التيارات الجديدة , فكان في وضع المرغوب به دوليا لمواقفه الدولية وتسهيل مهمة الناتو والأقل رغبة محليا لعدم إتخاذه مواقف ثورية علنية تؤكد تلك الأغنية ....لذلك أعتقد أن البدليل أحمد شفيق أكثر قربا من أصوات هذا التيار ....هذا ما جعل من يحصون الأنفاس أن يتقدموا بلعبة حمدين صباحي , والذي بدأ ترشيحه من البرادعي وإنتهى بمساندة وائل غنيم , رغم أن البرادعي ووائل غنيم في خانة لا يمكن تسجيلها في مركب الناصرية أو الإشتراكية ....أليس كذلك ؟.....أما عن ترشيحك لمحمد مرسي ...فأعتقد أن التابع لن يكون في وضع قيادي يقود به شعب في أهمية شعب مصر وطبعا هذا رأي أستنتجه من فوز حماس في غزة وما حدث بعدها من إنقيادها للخارج أكثر مما إنقادت للشعب الذي إنتخبها, وهذا ليس إختيارا ولكنه سطوة المال , والمال هو القائد هذا الزمان , ومشروع النهضة الذي تدعوا له جماعة الأخوان مشروع ...صنع خارج مصر ...وله أهداف ويمكن لك البحث عنه في ظلمات الشبكة فهو موجود

أنا لاحظت من حواري ونقاشي على الشَّابِكَة (الإنترنت) أنَّ مُثَّقَّف دولة الفَلسَفَة يقول في العادة شيء وهو يعني شيء ثان والمأساة يفعل شيء ثالث يختلف تماما، والأنكى أن يعتبر ذلك شيء طبيعي وليس به أي خطأ يتطلب العمل على تصويبه؟
بينما عند الذين يؤمنون بالله واليوم الآخر يجب أن يكون للون الأبيض معنى يختلف عن اللون الأسود فالفوضى الخلاّقة هي التي تعمل على أن نصاب بعمى الألوان من خلال استغلال الصلاحيات الإدارية لحذف ما يشاء والإبقاء على ما يشاء من أجل خلط الحابل بالنابل للتشويش لجعل كل الألوان رماديّة، كما يقوم بذلك أصحاب الصلاحيات الإدارية في أي موقع على الشَّابكة (الإنترنت) لتمرير أو توجيه أو حرف النقاش إلى شيء هي تريده حسب مزاجيتها وانتقائيتها.
فحسب ما ورد في المداخلة المقتبسة لاسماعيل الناطور المال هو القائد، هذا الزمان، ولذلك جمال عبدالناصر اختار المال بدل المبادئ، كما أن محمد أنور السادات اختار المال بدل المبادئ، كما محمد حسني مبارك اختار المال بدل المبادئ، كما أن أحمد شفيق حسب الدعوى التي رفعت ضده الآن في المحاكم أصلا لكي يتم ترقيته وتسليمه كل المناصب مقابل أن يقوم بالموافقة على بيع أرض حكومية تم تخصيصها من الدولة للقوات الجوية فيقوم ببيعها لعلاء مبارك نيابة عن جمال مبارك بتراب الفلوس من أجل المال بدل المبادئ، ولذلك الآن يختاره اسماعيل الناطور من يدعي أنّه من اتباع جمال عبدالناصر لأنه قومي عربي.
في حين أن اسماعيل الناطور يلوم حماس بحجة أنها لم تقبل أن تحجر فكرها داخل حدود قطاع غزة فقط، في تناقض فاحش مع أبسط مفاهيم اللغة العربية، على الأقل من وجهة نظري.
حيث موطن اللغة العربية لا يمكن تحديده بحدود سايكس وبيكو لأي وطني قومي عربي لو كان حقيقة اتباع محمد حسنين هيكل وجمال عبدالناصر لهم أي علاقة بالقومية العربية،
ولكن لا غرابة على من يقوم بتحليل السرقة بدل تحريمها كما حصل في موضوع التأميم والإصلاح الزراعي وهي سرقة تحت مسميات برّاقة، كما هو الحال في خيانة قضية فلسطين وأصبحت وطنية أن تتنازل عن ثلاثة أرباع فلسطين وتوافق على مشروع روجرز الاستسلامي تخاذلي وخياني حسب كلام جمال عبدالناصر ومحمد حسنين هيكل نفسه؟!!! والذي لا محمد حسني مبارك ولا قبله محمد أنور السادات ولا حتى تلميذه محمود عباس أو محمد دحلان أتباع التنسيق الأمني مع الكيان الصهيوني لضرب كل انواع المقاومة بلا حياء ولا خجل تجاوزه قيد أنملة.
أي تهريج وأي مسخرة يقوم بها اتباع جمال عبدالناصر ولذلك من الطبيعي أن يكون هؤلاء مطية الغرب والتنسيق الأمني مع الكيان الصهيوني ليتقدموا الصفوف في الثورة المضادة للدفاع عن الفلول وتبرير كل جرائمهم بلا حياء ولا خجل كما هو حال ما سطره اسماعيل الناطور فيما نشره في هذا الموضوع،
إن لم يكن أصلا كان دوره فقط هو النقل والتكرار مثل الببغاء؟ فلذلك أنا أضفت تكملة لـ ناقل الكفر ليس بكافر ولكنّه في تلك الحالة على الأقل مثقف ببغائي ومسبب للفتن
ما رأيكم دام فضلكم؟

اسماعيل الناطور
05-15-2012, 02:53 PM
سؤال يراود مخيلتي دائماً لماذا تساند أحمد شفيق وعمرو موسي مع أنهم بقايا مبارك المعادي في العلاقات مع سوريا والذي قمتم في سوريا بتوصيفه بال العميل ثم سقط مبارك وهللتم وطبلتم في سوريا وهاهو استنساخه يجري لخلافته وهأنتم تدعموه لماذا لن تكفي علامات إستفهام أم إنها حاجة في نفس يعقوب تخشون الإسلاميين وخاصة السلفيين لماذا أراكم قلتم نرتضي بإحلي الوحشيين أتذكر مقاطعة البرلمان المصري المتمثل في أغلبيته للبرلمان السوري ودعمه للثورة وكذلك تصريحات مرسي بشان حزب الله...




إلى من لا يريد أن يقرأ ما نكتب حتى لا يقع فريسة الفهم

مرشحي الشخصي هو محمد سليم العوا صاحب أكثر من خمسين كتابا في الفكر الإسلامي
والذي يتضاءل حوله محمد مرسي وأبو الفتوح لدرجة الأصفار فكرا وشخصية وصدق وعمل عام
ولكنه لن ينجح في ظل موازيين قوى لا تعتمد في مجملها على الواقع والحقائق
بل تعتمد على التخطيط الإعلامي
وتغيب الوعي تحت قوة المال
وفي جو من قلة الوعي الإنتخابي والذي أسسوا له من فترات طويلة ,
من يخاف الاسلام هو معتوه العقل والضمير ,
ولكن من يسير وراء من يتخذ دين لشراء كرسي في الدنيا هو معتوه العقل والضمير

أبو صالح
05-15-2012, 04:08 PM
ثورة الحمير بقلم/ اسماعيل الناطور
رئيس على واحدة ونص بقلم/ اسماعيل الناطور
إلى من لا يريد أن يقرأ ما نكتب حتى لا يقع فريسة الفهم
مرشحي الشخصي هو محمد سليم العوا صاحب أكثر من خمسين كتابا في الفكر الإسلامي
والذي يتضاءل حوله محمد مرسي وأبو الفتوح لدرجة الأصفار فكرا وشخصية وصدق وعمل عام
ولكنه لن ينجح في ظل موازيين قوى لا تعتمد في مجملها على الواقع والحقائق
بل تعتمد على التخطيط الإعلامي
وتغيب الوعي تحت قوة المال
وفي جو من قلة الوعي الإنتخابي والذي أسسوا له من فترات طويلة ,
من يخاف الاسلام هو معتوه العقل والضمير ,
ولكن من يسير وراء من يتخذ دين لشراء كرسي في الدنيا هو معتوه العقل والضمير


إن كان هناك معتوه وانسان بلا ضمير فهو أنت يا اسماعيل الناطور والدليل ما قمت به تجاهي بالرغم من كل ما فعلته لك يا خائن المعروف،
كفى استهزاء وسفاهة بمرشحي الرئاسة الذين تختلف معهم يا اسماعيل الناطور فقد وصل الكيل الزبى خصوصا وأنت مع المرشح الذي تفضله إيران، والسؤال هنا لماذا؟
ولأقول لك شيء بصراحة أنت يا اسماعيل الناطور ووفاء عرب واساليبكم في الردح السوقي المبتذل لكل من اختلفتم معه كانت سبب سوء فهم محمد رندي وحكيم عباس لتصرفاتي، عندما كان كل منكما بعد أن يعتدي عليهما يأتي ويحتمي بي في النخبة عند يوسف الديك أو الملتقى عند محمد شعبان الموجي، والذين تسجيلهما في الملتقى هو ما جعلني أكمل مشاركاتي المشروطة في الملتقى في حينها كما أوضحتها لمحمد برجيس
بعد أن كتبت مداخلتي ضد محمد شعبان الموجي لمنع الهجوم المحتمل ضد البنت العراقية (طالبة) التي دافعت عنك في الملتقى عندما كان يحاربك سعيد وشراب وأبو يزن، حيث أنني خبير بأسلوب الموجي ضد أي معارضة له ولشلته
وبناءا على ما نشرته في المواضيع والتي عناوينها أعلاه أثبتت أنت انسان ببغائي التصرّف في كل ما يتعلق بانتفاضات أدوات العولمة
والمصيبة في حالتك أنت كنت ببغاء لصعلوك منحط ألا وهو د. توفيق عكاشة صاحب قناة الفراعين وهو من كان يقبل أيادي صفوت الشريف في كل مكان يلقاه به، وصفوت الشريف لمن لا يعرفه كان عرّاب استغلال الفنانين والفنانات في الدعارة السياسيّة مثل سعاد حسني وغيرها من خلال تسجيل أفلام خلاعية لهم مع أصحاب السلطة والقرار العربي من أجل أن يمرر جمال عبدالناصر ومحمد حسنين هيكل ما يرغبون به من سياسات تبين بالدليل العملي خدمة الكيان الصهيوني والدليل على ذلك فضيحة وعار هزيمة عام 1967 أو معاهدة روجرز التي تتنازل على ثلاثة أرباع فلسطين للكيان الصهيوني،
فأريد أن أفهم أي أخلاق وأي دين تسمح بمثل هذه الدعارة والدناءة والخسّة الحقيقيّة لجمال عبدالناصر ومحمد حسنين هيكل ورجال نظامه الذي كان أبعد ما يكون عن القوميّة وخصوصا العربيّة الإسلاميّة والتي تمثل ثقافة الـ نحن
بل أن جمال عبدالناصر ومحمد حسنين هيكل ونظامهما أول من اسس للقُطريّة حسب مفهوم الثورة الفرنسية وعمل على ترسيخ حدود سايكس وبيكو داخل عقولنا تماما، لتعزيز ثقافة الـ أنا وبشكل أناني صرف.
والدليل على ذلك موقفك أنت يا اسماعيل الناطور كما بينته في سبب اعتراضك على مواقف حماس،
فأن كنت تدري فتلك مصيبة وإن كنت لا تدري فالمصيبة أعظم يا اسماعيل الناطور
اللهم هل بلغت اللهم فأشهد

اسماعيل الناطور
05-15-2012, 10:05 PM
...الاسم: محمد سليم العوَّا
تاريخ الميلاد: 22/12/1942م.
المهنة: محام بالنقض ومحكم دولي، أستاذ جامعي سابق.
الحالة الاجتماعية: متزوج وله ثلاث بنات وولدان، وسبعة من الحفدة.
المؤهلات العلمية:
1- دكتوراه الفلسفة ( في القانون المقارن ) من جامعة لندن – 1972.
2- دبلوم القانون العام من كلية الحقوق - جامعة الإسكندرية – 1965.
3- دبلوم الشريعة الإسلامية من كلية الحقوق - جامعة الإسكندرية – 1964.
4- ليسانس الحقوق من كلية الحقوق - جامعة الإسكندرية - 1963.
الخبرات:
1- الأمين العام للاتحاد العالمي لعلماء المسلمين.
2- عضو مجمع اللغة العربية بالقاهرة.
3- عضو مجمع الفقه الإسلامي الدولي ـ منظمة المؤتمر الإسلامي.
4- عضو عامل في أكاديمية مؤسسة آل البيت المَلَكِيّة للفكر الإسلامي، الأردن.
5- رئيس جمعية مصر للثقافة والحوار.
6- عضو المجلس الأعلى للمجمع العالمي للتقريب بين المذاهب الإسلامية ـ طهران ـ الجمهورية الإسلامية الإيرانية.
7- عضو مؤسس في الفريق العربي للحوار الإسلامي المسيحي، وعضو لجنته الإدارية.
8- عضو المجلس الأعلى ومجلس الخبراء لمركز دراسات مقاصد الشريعة الإسلامية، مؤسسة الفرقان للتراث الإسلامي، لندن.
9- عضو من الخارج في مجلس كلية دار العلوم ـ جامعة القاهرة.
10- عضو مجلس إدارة مركز الدراسات الإسلامية بجامعة القاهرة (مركز تابع لكلية دار العلوم).
11- عضو مؤسس وعضو اللجنة التنفيذية لمركز دراسات العالم الإسلامي (مالطة).
12- عضو هيئة تحرير مجلة المسلم المعاصر.
13- عضو الهيئة الاستشارية لمجلة (Law & Religion) التي تصدرها كلية الحقوق بجامعة Hamline في ولاية Minnesota الأمريكية.
14- عضو الهيئة الاستشارية لمجلة (الحياة الطيبة) التي يصدرها معهد الرسول الأكرم صلى الله عليه وسلم العالي للشريعة والدراسات الإسلامية، بيروت، لبنان.
15- عضو مجلس أمناء المنظمة المصرية لحقوق الإنسان (1994-2000).
16- أستاذ محاضر بكلية الحقوق جامعة عين شمس (دبلوم التحكيم وبرنامج الزمالة في التحكيم التجاري الدولي).
17- أستاذ غير متفرغ بحقوق الزقازيق ( 1985 - 1994 ).
18- مستشار مكتب التربية العربي لدول الخليج ـ الرياض ـ المملكة العربية السعودية 1979 - 1985.
19- أستاذ للفقه الإسلامي والقانون المقارن ـ قسم الدراسات الإسلامية بجامعة الرياض (الملك سعود حالياً ) ـ الرياض ـ المملكة العربية السعودية 1974 - 1979.
20- أستاذ مساعد للقانون المقارن ـ كلية عبد الله بايرو ـ جامعة أحمد وبللو ـ كانو ـ نيجيريا 1972-1974.
21- طالب بحث (متفرغ) بقسم الدكتوراه ـ مدرسة الدراسات الشرقية والإفريقية ـ جامعة لندن 1969 - 1972.
22- محام بإدارة الفتوى والتشريع بمجلس الوزراء الكويتي 1967 - 1969 ( في إعارة من هيئة قضايا الدولة المصرية ).
23- محام في هيئة قضايا الدولة بمصر 1966 - 1971.
24- وكيل النائب العام 1963 - 1966.
النشاطات العلمية:
1- أستاذ زائر في القانون المقارن لكلية الدراسات الاجتماعية بجامعة أم درمان الإسلامية ـ السودان 1976 و1977.
2- عضو اللجنة الفنية لتعديل القوانين السودانية بما يتفق مع الشريعة الإسلامية، 1977 – 1980.
3- عضو المجلس التنفيذي للمعهد العالمي للاقتصاد والبنوك الإسلامية، 1981 (حتى انتهاء عمل المعهد في 1985).
4- ممتحن خارجي لدراسات برنامج الأنظمة (القوانين) في معهد الإدارة العامة بالرياض في السنوات من 1974 إلى 1983.
5- قدم استشارات لجامعة قطر لإعداد مشروع قانونها ولائحتها التنفيذية، 1982.
6- قدم استشارات لتعديل مناهج الدراسات الإسلامية والعربية لجامعة محمد الخامس ـ المغرب 1985.
(بالاشتراك مع الأستاذ الدكتور أحمد المهدي عبد الحليم الأستاذ بكلية التربية، جامعة عين شمس).
7- كلف بإعداد : إعلان مكتب التربية العربي لدول الخليج لأخلاق مهنة التعليم ( صدر عن مؤتمر وزراء التربية بدول الخليج ) 1985.
8- كلف بإعداد ميثاق الدوحة للناشرين الخليجيين (صدر عن مؤتمر وزراء التربية بدول الخليج) 1985.
9- شارك في إعداد وكلف بتحرير كتاب: مناهج المستشرقين في الدراسات العربية والإسلامية، المنظمة العربية للتربية والثقافة والعلوم ومكتب التربية العربي لدول الخليج، 1985.
10- عضو المجموعة القانونية الاستشارية لبنك فيصل الإسلامي المصري، 1985 – 1994.
11- أشرف على، واشترك في مناقشة، رسائل للماجستير والدكتوراه في الشريعة الإسلامية والقانون المقارن والعلوم السياسية بجامعات الرياض (الملك سعود) والإمام محمد بن سعود الإسلامية، والقاهرة، وعين شمس.
12- عضو مجلس أمناء جامعة الخليج العربي ـ البحرين ـ (ضمن ثلاث من الشخصيات العربية ذات الوزن الدولي في مجال التعليم العالي طبقاً النظام الأساسي للجامعة) 1986 – 1989.
13- عضو اللجنة الدولية لإعادة النظر في قوانين السودان الإسلامية، 1986 - 1987 (لجنة من ثمانية من العلماء ورجال القانون شكلتها حكومة السودان ـ بعد الرئيس جعفر نميري ـ للنظر في القوانين الإسلامية واقتراح تعديلها بما يجعلها أكثر اتفاقاً مع الشريعة الإسلامية وملاءمة لواقع السودان، وقد قدمت اللجنة تقريرها إلى الحكومة السودانية وتم اعتماد توصياتها بقرار الجمعية التأسيسية في السودان).
14- عضو الجمعية الدولية للعلماء الاجتماعيين المسلمين (الولايات المتحدة الأمريكية).
15- شارك في تحرير كتاب التربية العربية والإسلامية (وهو مرجع في ثلاثة مجلدات يجمع أصول التربية الإسلامية ومفكريها ومدارسها، وصدر المجلد الأول منه عن المنظمة العربية للتربية والثقافة والعلوم ـ تونس 1987، والمجلدان الثاني والثالث عن مجمع آل البيت بالأردن ومكتب التربية العربي لدول الخليج بالرياض عام 1988).
16- شارك في إعداد وتحرير موسوعة الشروق للفكر الإسلامي (القاهرة 1993 ـ مستمرة في الصدور).
17- شارك في تحرير موسوعة سفير الإسلامية للناشئين (القاهرة 1995 ـ مستمرة في الصدور).
18- شارك في تحرير الموسوعة الإسلامية التركية (استنبول 1994 ـ مستمرة في الصدور).
19- حرر كتاب مقاصد الشريعة الإسلامية (دراسات في قضايا المنهج ومجالات التطبيق)، مركز دراسات مقاصد الشريعة الإسلامية، مؤسسة الفرقان للتراث الإسلامي، لندن 2006.
20- حرر (بالاشتراك) كتاب (الإرهاب جذوره، أنواعه، سبل علاجه)، مؤسسة الفرقان للتراث الإسلامي، لندن، 2005.
21- له مئات من الدراسات والبحوث والمقالات المنشورة في كتب قانونية وفقهية متخصصة، وفي المجلات القانونية والإسلامية والثقافية.
22- شارك في عديد من المؤتمرات والندوات العلمية القانونية والإسلامية والتربوية في مختلف أنحاء العالم.
مؤلفات باللغة العربية:
(أ) الكـتب :
1- في النظام السياسي للدولة الإسلامية، الطبعة الأولى 1975، الطبعة التاسعة 2008، دار الشروق، القاهرة.
2- في أصول النظام الجنائي الإسلامي، الطبعة الأولى 1979، دار المعارف بمصر، الطبعة الخامسة 2007، دار نهضة مصر،القاهرة.
3- تفسير النصوص الجنائية، دار عكاظ، جدة 1981.
4- الأقباط والإسلام : حوار 1987، دار الشروق 1987، القاهرة (نفد).
5- العبث بالإسلام في حرب الخليج، 1990، الزهراء للإعلام العربي، القاهرة.
6- الأزمة السياسية والدستورية في مصر ( 1987 – 1990) 1991، الزهراء للإعلام العربي، القاهرة.
7- أزمة المؤسسة الدينية في مصر، 1998، دار الشروق، القاهرة.
8- الحق في التعبير، الطبعة الثانية 2003، دار الشروق، القاهرة.
9- الفقه الإسلامي في طريق التجديد، الطبعة الثالثة 2007، سفير الدولية للنشر، القاهرة؛ الطبعة الرابعة 2008 دار الزمن، المغرب.
10- طارق البشري فقيهاً،1999، دار الوفاء، المنصورة.
11- الإسلاميون والمرأة، 2000، دار الوفاء، المنصورة.
12- شخصيات ومواقف عربية ومصرية، 2004، دار المعرفة، بيروت.
13- النظام السياسي في الإسلام، 2004،حوار مع الدكتور برهان غليون، دار الفكر، دمشق.
14- للدين والوطن: فصول في علاقة المسلمين بغير المسلمين، دار نهضة مصر، الطبعة الثالثة، 2009.
15- القاضي والسلطان، 2006، دار الشروق، القاهرة.
16- بين الآباء والأبناء، تجارب واقعية، الطبعة الرابعة 2008، نهضة مصر، القاهرة.
17- دور المقاصد في التشريعات المعاصرة، الطبعة الثانية 2006، مركز دراسات مقاصد الشريعة الإسلامية، مؤسسة الفرقان للتراث الإسلامي، لندن.
18- ثورة يوليو والإسلام، 2006، دار الشروق الدولية، القاهرة.
19- العلاقة بين السنة والشيعة، الطبعة الأولى 2006، سفير الدولية للنشر؛ الطبعة الثانية 2006 دار الزمن، المغرب.
20- الدين والدولة في التجربة المصرية، 2007، سفير الدولية للنشر، القاهرة.
21- في ظلال السيرة: الحديبية، 2007، مكتبة وهبة، القاهرة.
22- دراسات في قانون التحكيم، 2007 المركز العربي للتحكيم، القاهرة.
23- الإسلام والعصر، الطبعة الأولى، مكتبة الشروق الدولية، مصر 2007 والطبعة الثانية 2008.
24- الوسطية السياسية، 2007، المركز العالمي للوسطية، الكويت.
25- مقاصد السكوت، الطبعة الأولى 2007، مركز دراسات مقاصد الشريعة الإسلامية، مؤسسة الفرقان للتراث الإسلامي، لندن.
26- أسرتنا بين الدين والخلق، 2008، دار المعرفة، بيروت.
(ب) الدراسات والبحوث:
1- جريمة شرب الخمر وعقوبتها في الشريعة الإسلامية، المجلة العربية للدفاع الاجتماعي، (المنظمة العربية للدفاع الاجتماعي ـ جامعة الدول العربية) العدد الخامس، 1973.
2- الدين المزعوم للقانون الروماني على الشريعة الإسلامية، بحث مترجم من الإنجليزية إلى العربية مع تعليقات وتعقيبات، نشر ضمن كتاب الشريعة الإسلامية والقانون الروماني، دار البحوث العلمية، بيروت، 1973.
3- السنة التشريعية وغير التشريعية، المسلم المعاصر، العدد الافتتاحي، بيروت 1974.
4- قضاء المظالم في الشريعة الإسلامية وتطبيقه في المملكة العربية السعودية، مجلة إدارة قضايا الحكومة، القاهرة 1974.
5- بين الاجتهاد والتقليد، المسلم المعاصر، العدد الرابع، بيروت 1975.
6- التعزير في الفقه الجنائي الإسلامي، مجلة إدارة قضايا الحكومة، العدد الأول، السنة الثالثة والعشرون، 1976.
7- مبدأ الشرعية في القانون الجنائي المقارن، المجلة العربية للدفاع الاجتماعي، العدد السابع، مارس 1978.
8- أسس التشريع الجنائي الإسلامي مع الإشارة بصفة خاصة إلى مبدأ الشرعية، المجلة العربية للدفاع الاجتماعي، العدد العاشر - أكتوبر 1979.
9- النظام القانوني الإسلامي في الدراسات الاستشراقية المعاصرة، فصل في كتاب: مناهج المستشرقين في الدراسات العربية والإسلامية، صدر عن المنظمة العربية للتربية والثقافة والعلوم ومكتب التربية العربي لدول الخليج 1985.
10- مناهج المستشرقين في الدراسات العربية والإسلامية (دراسة عن كتاب)، المجلة العربية للثقافة (المنظمة العربية للتربية والثقافة والعلوم) العدد الثامن، مارس 1985.
11- صحيفة المدينة والشورى النبوية، دراسة قدمت إلى ندوة النظم الإسلامية (أبو ظبي: 11-3/11/1984) ونشرت ضمن بحوث الندوة في كتاب صدر عن مكتب التربية العربي لدول الخليج ـ الرياض 1987.
12- الجرائم الخلقية الماسَّة بالأسرة في الشريعة الإسلامية والتشريعات العربية، دراسة قدمت إلى مؤتمر حماية الأسرة الذي نظمته كلية الحقوق بجامعة الإسكندرية، ديسمبر 1985، ونشرت في مجلة المحاماة، العددان 5، 6 مايو ويونيو 1987 ثم أعادت نشره جامعة قطر في العدد الخامس من حولية كلية الشريعة والدراسات الإسلامية، 1987.
13- النظام الإسلامي ووضع غير المسلمين، دراسة قدمت إلى مؤتمر المجلس الإسلامي بالسودان عن: إقامة النظام الإسلامي، فبراير 1987 ونشرت في العدد الخامس من مجلة: الحوار الدولية في السنة نفسها.
14- العرب والشورى بعد أزمة الخليج، ضمن كتاب أزمة الخليج وتداعياتها على الوطن العربي، مركز دراسات الوحدة العربية، بيروت 1991.
15- تنظيم الدفاع عن حقوق الإنسان محاولة للتأصيل من منظور إسلامي، ندوة حقوق الإنسان، المهرجان الثقافي الوطني ـ المملكة العربية السعودية ـ إبريل 1994، ثم نشرت في مجلة المنظمة المصرية لحقوق الإنسان؛ ثم نشرت في كتاب (حقوق الإنسان في الإسلام)، مؤسسة الفرقان للتراث الإسلامي، لندن 2004.
16- حقوق المرأة في ضوء المؤتمر العالمي للسكان المنعقد بالقاهرة في سبتمبر 1994، ندوة جمعية الحقوقيين والاتحاد النسائي بدولة الإمارات العربية المتحدة.
17- الدين والبِنَى السياسية وجهة نظر إسلامية، مركز الدراسات المسيحية ـ الإسلامية، جامعة البلمند، طرابلس، لبنان سبتمبر 1996.
18- الوحدة الإنسانية والتعدد الديني، مركز الدراسات المسيحية ـ الإسلامية، جامعة البلمند، طرابلس، لبنان سبتمبر 1996.
19- العلاقة بين المسلمين وغير المسلمين، مفاهيم أساسية. المسلم المعاصر، العدد 85 السنة الثانية والعشرون (أغسطس / أكتوبر 1997).
20- جنسية أبناء المصرية من أجنبي (وجهة نظر إسلامية)، حقوق الإنسان، العدد (29) إبريل 1997.
21- العملية التشريعية من المنظور السياسي والاجتماعي والأخلاقي، مركز الدراسات والبحوث السياسية، كلية الاقتصاد والعلوم السياسية، جامعة القاهرة، فبراير 1999.
22- مائة عام من الفكر السياسي الإسلامي في مصر، مركز الدراسات والبحوث السياسية، كلية الاقتصاد والعلوم السياسية، جامعة القاهرة، ديسمبر 1999.
23- رؤى في الإدارة والتربية، كتاب مؤتمر مديري التعليم بالمملكة العربية السعودية، وزارة المعارف، فبراير 2000.
24- نظرات في مسألة الشورى والديمقراطية، جمعية الدعوة الإسلامية العالمية ومجمع الفقه الإسلامي ـ لندن ـ أكتوبر 2000.
25- القدس في ضوء فكرة دار الإسلام ودار الحرب، مجمع البحوث الإسلامية، كلية الدراسات الشرقية والإفريقية، جامعة لندن، أكتوبر 2000.
26- الاجتهاد المعاصر . . كيف يكون ؟، جامعة الخليج العربي ـ البحرين ـ نوفمبر 2000.
27- المواطنة بين شرعية الفتح وشرعية التحرير، معهد الدراسات العربية والإسلامية ـ لندن، المعهد، العدد الثالث، رجب 1422هـ = تشرين الأول 2001.
28- مشاركة المرأة في العمل العام رؤية إسلامية، مركز البحوث والدراسات السياسية، كلية الاقتصاد والعلوم السياسية، جامعة القاهرة، يوليو 2001.
29- القيم والتربية، جامعة السلطان قابوس والمجمع الثقافي العربي ـ مسقط ـ أكتوبر 2001.
30- حقوق المدنيين في أثناء النزاعات المسلحة، جنيف، 2002.
31- التيار الإسلامي وتجديد الفكر السياسي، المؤتمر الخامس عشر لقسم العلوم السياسية بكلية الاقتصاد والعلوم السياسية، جامعة القاهرة، يناير 2002.
32- أهل الذمة في النظام الحقوقي الإسلامي، رؤية إسلامية معاصرة، مجلة الحياة الطيبة، عدد (11) بيروت 2003.
33- تعقيب على ورقة الدكتور جورج جبور المعنونة: (تأملات موجزة في العلاقة بين الأديان من الحرب إلى السلم)، المؤتمر الدولي لحقوق الإنسان، تونس، يونيو 2003.
34- جهود القرضاوي لخدمة السنة النبوية، في مجلد تكريم الشيخ يوسف القرضاوي بمناسبة بلوغه السبعين، كلية الشريعة والقانون، جامعة قطر، 2003.
35- القيم التي أسهمت في صنع الحضارة العربية الإسلامية، الحوار المصري الألماني، الإسكندرية، سبتمبر 2003.
36- الثقافة العربية الإسلامية.. إشكالية الثوابت والمتغيرات في ظل العولمة وحوار الحضارات، برنامج حوار الحضارات، كلية الاقتصاد والعلوم السياسية، يناير 2004.
37- ثقافة التغيير: وجهة نظر إسلامية، دراسة مقدمة إلى مؤتمر مؤسسة الفكر العربي الثالث، مراكش، المغرب 2004.
38- تعقيب على دراسة: في معنى التنوير للدكتور فيصل دراج، ندوة حصيلة العقلانية والتنوير في الفكر العربي المعاصر، مركز دراسات الوحدة العربية، بيروت، ديسمبر 2004.
39- المعلم وثقافة الأمة، دراسة مقدمة إلى المؤتمر الدولي الثالث لكلية التربية، جامعة السلطان قابوس، مسقط، سلطنة عمان، مارس 2004.
40- المذهبية والوحدة الفكرية الإسلامية، المؤتمر الإسلامي الدولي، مؤسسة آل البيت للفكر الإسلامي، عمان، الأردن، يوليو 2005.
41- التسامح من منظور إسلامي، اللجنة الوطنية لليونسكو، بيروت، نوفمبر 2005.
42- الشهادة بين قيم الدين وقيم المواطنة، معهد المعارف الحِكمية، بيروت، مايو 2007.
43- مدى جواز حصر الإفتاء في جهة معينة في كل دولة، المركز العالمي للوسطية، الكويت، نشر في كتاب مؤتمر الإفتاء في عالم مفتوح. مايو 2007.
44- المسلم والآخر، مكتبة الإسكندرية، أكتوبر 2007.
45- الاجتهاد وشروط ممارسته، دراسة في كتاب الإسلام والتطرف الديني، تحرير أ.د. الطيب زين العابدين، القاهرة 2008.
46- العنف الأسري، مؤتمر الحماية القانونية للأسرة، البحرين، ديسمبر 2008.
من البحوث المنشورة في قانون التحكيم:
2- اختيار المحكَّم وواجباته، دراسة قدمت إلى مؤتمر التحكيم الأول بنقابة المهندسين ونشرت في كتاب المؤتمر القاهرة، 1991.
3- اختيار المحكَّمين واختيار أماكن التحكيم، الدورة الثالثة لإعداد المحكَّمين في المنازعات الهندسية، نقابة المهندسين، القاهرة، 1992.
4- إجراءات التحكيم وحالات البطلان في منازعات عقود FIDIC، الدورة الرابعة لإعداد المحكَّمين في المنازعات الهندسية، نقابة المهندسين، القاهرة، 1993.
5- القانون رقم 27 لسنة 1994 في شأن التحكيم التجاري في مصر، دراسة قدمت إلى ندوة جمعية المهندسين المصرية عن التحكيم في ظل القانون الجديد، القاهرة 1995.
6- حكم التحكيم وبطلانه، 1998.
7- التحكيم في قوانين البلاد العربية، 1998.
8- إدارة التحكيم: دراسة في الإجراءات المدنية، 1999.
9- اختيار المحكمين ومكان التحكيم، الدورة الأولى للعقود وإعداد المحكمين، اتحاد المهندسين العرب، عمان 2000.
10- سلوك المحكمين، مجلة التحكيم العربي، العدد الثالث، القاهرة، أكتوبر 2000.
11- حكم التحكيم، دمشق 2001.
12- إجراءات التحكيم في القانون المصري، مجلة التحكيم العربي، العدد الرابع، القاهرة، أغسطس 2001.
13- شرط التحكيم في الفقه الإسلامي، ندوة التحكيم في الشريعة الإسلامية، مركز التحكيم التجاري لدول مجلس التعاون لدول الخليج العربي، دبي 2001.
14- مدى جواز تعديل حكم التحكيم في القانون المصري، مجلة التحكيم العربي، العدد الخامس، القاهرة، سبتمبر 2002.
15- التحكيم وشرطه في الفقه الإسلامي، المؤتمر الثاني للتحكيم الهندسي، الرياض 2002.
16- التحكيم في الأعمال المصرفية الإلكترونية، الإمارات، 2003.
17- القانون واجب التطبيق في منازعات التحكيم، دورة إعداد المحكمين العرب الدوليين، القاهرة 2007.
18- مبدأ السرية في التحكيم: ما له وما عليه، برنامج إعداد المحكمين، مركز التحكيم، كلية الحقوق، جامعة عين شمس، القاهرة، مارس 2008.
19- مراكز التحكيم العشوائية في العالم العربي، المؤتمر السادس للاتحاد العربي للتحكيم الدولي، عمان، ديسمبر 2008

سلوى فريمان
05-16-2012, 05:00 AM
السيد اسماعيل الناطور ، أسعد الله صباحك
لقد تابعت موضوعك عن ثورة الحمير إلى الصفحة الخمسين
ثم توقفت .. أنا أعاني من مرض "الربو" الذي كما
تعلم يجعل من التنفس عملية شاقة إن تعرض صاحبه
لمناخات هوائية محملة بالغبار و مناخات باردة رطبة
و أيضاً إن تعرض الحس و العقل إلى جفاف في المنطق
و في التصوير العاقل لظروف لا نستطيع أن نعتبرها في
أمتنا عاقلة ، يبدأ السعال و تتجرح بين الضلوع الرئة
و تصبح إجازة النقاهة واجبة..
عدت اليوم لأرى هل حميرك لا تزال على قيد الحياة
لأنني و منذ اسبوعين تكلمت عن حمار (حقيقي) واحد و يتيم
ما أشعل حرباً (لم تبدأ كباقي الحروب بمعركة) استُخدم فيها
كل أسلحة اليوم المشروعة من حقد طائفي و مذهبي و عرقي
إلى التعرض للوضع الشخصي بكل مكوناته و بدون تروي
بل كانت سمة "داء الكَلَب" تلفه بخيط مسعور و غبي و أحمق ..

أنت اليوم في صفحتك المئوية ما يؤكد لي أنك و الشكر لله
لا تعاني من داء الربو و لا من ضيق الصدر و إنما برحابة
تستوعب كل ما يقذفه الموج الهائج من عث و ثمين ..

إسمح لي أن أخبر حمير الثورة في موضوعك عن برنامج عُرض منذ يومين
على التلفزيون الأسترالي عن تجارة الجمال (كسرة على الجيم و ليس فتحة).
و علمنا أن عربان المحميات في شبه الجزيرة العربية تستورد جمال السباق
من مزراع لها في استراليا و ما قاله التقرير (فيديو) أن الجمال تُشحن من
استراليا بطريقة راقية إلى بلاد العربان حيث يكون باستقبالها ممثلو أمراء
السبق بشاحناتهم الفخمة و ينقلون الجمال إلى فندق فخم في قلب الصحراء
مزود بالمسابح الدافئة و عاملات صالونات التجميل اللواتي وُظفن للإعتناء
بحوافر الجمال و تقليم أخفافها و أظافرها .. هذه ليست أسطورة بل حقيقة
أنهى مقدم البرنامج بثه بقوله الساخر : ألا يوجد لدى هؤلاء الأمراء أية "شغلة"
ثانية يصرفون هذه الأموال الطائلة عليها ؟؟ ألا يوجد في بلادهم فقر يحتاج لهذه الأموال ؟؟
و هنا أريد أن أقول لحمير الثورة المستعربة أنهم مغبونون و عليهم أن يُطالبوا من "يَسُوقهم" بتحسين
ظروفهم و معيشتهم كي يتساووا مع الجمال المرَهّفة القادمة من
قارة الكانجاروو على الأقل من خلال تأمين ليس مسابحاً دافئة بل
"حنفية" ماء باردة تغسل عرق "السخرة" عن ظهورهم ..

هنيئاً لحمير الثورة الذين أثبتوا أن حماري الذكي راح ضحية رفاق ثورتهم
بسبب "حمرنتهم" لا أكثر ..

تحيتي و تقديري و شكري ..

اسماعيل الناطور
05-16-2012, 09:11 AM
الكوميديـا الرئاسيـه


..همّ يضحك و همّ يبكي.. أنا استعجبت خالص من الرموز الرئاسيه ..!! يعني مش كان كفايه يلطعولنا صورة كل واحد مترشح .. اللي لا تسر عدو ولا حبيب.. و عامله زي صور البطايق الشخصيه اللي بيعزبو بيها الشعب طول العمر ..؟! لأ ..كمان .. يحطولنا جنبهم رموز تهلك من الضحك..!!

قال إيه مرشح رئاسي معرفش أسمه إيه..؟! رمز البلّطه ..يعني هيبتديها بلطجه من الأول كده..!! ..ولا يكنش دا ..إللي هيهد البلد ..و يبنيها من الأول.. ولا دي رمز هيبة الأمن أو ضياعه..!!..أهو على الأقل تنفعه بعدين ..و يقدر يدافع بيها عن نفسه..!!

الحمد لله أنهم مجبوش لنا رمز المطوه .. ولا السنجه ..ولا الساطور ..ولا رمز المسدس اللي كان مالي انتخابات مجلس الشعب ..بس دي انتخابات رئاسه ياناس مش أي كلام..!!

و واحد تاني معرفوش..!! رمز كاميرة تصوير سينمائي.. باين على البعيد كان مخرج.. ولا ممثل.. ولا حاجه..!! مع إن وشه مش فوتو جنيك خالص ..تقولش توأم سليمان..!! يمكن جاي عشان يصور حال البلد.. مهو أصل إللي بنى مصر كان في الأصل مشخصاتي..!!

وواحد تالت برضو معرفوش..!! ومش عارف مرشح نفسه ليه..؟! رمز العربيه ..و يا ريتها عربيه بحق وحقيق.. ولا ماركه محترمه.. لكن شكلها ولا العربيه اللعبه ..زي الأوتومبيلات بتاعه زمان إللي اكل عليها الدهر وشرب ..يعني دقه قديمه .. يمكن دا اللي هيجيب البلد لورا .. ويرجعها لأيام البهوات والبشوات بتوع زمان.. دا إذا كان فيها أصلاً فتيس ..و بيعرف يجيب مارشدير..!!

وواحد رابع عمري ماسمعت عنه..!! ولا أعرف بيشتغل في أنهي داهيه..؟! رمز النجمه.. إن جيتوا للحق هوا يستاهلها .. شكله ولا نجوم السيما بتوع زمان .. ولّا اعلانات البطاطس بتاعة اليومين دول..!! هو دا شكله اللي هيورينا النجوم في عز الظهر .. ولا يكون لسه قالع النجوم من على كتافه .. و تلاقيه برضوا عسكري ..ومتخفي زي غالبيه المترشحين..!!

وواحد أنا عارفه .. بس بيخوف .. خاصة لو طلع لنا في الضلمه .. رمز الشمسيه .. و استغربت إزاي يعني اختار رئيس جمهوريه رمزه الشمسيه ..؟! بالزمه مش عيبه.. يمكن هوا ده اللي هيضلل علي البلد ..و يحميها من الشمس و الشتا ..على رأي الست فيروز.. انتخبتك في الصيف ونطرتك في الشتا..!!

و واحد أنا بشبه عليه ..و مش عارف شفته فين قبل كده.. ؟! أيوه ..أيوه ..أيوه..!! هوا الراجل اللي كان عاوز يوزع على الثوار بنبون ورمزه السلم .. ماهو اكيد ..!! هوا ده اللي هياخد الشعب سلم .. علشان يوصل لكرسي الرياسه .. دا اللي طول عمره في بقه معلقه دهب .. و كلب للنظام.. وكان بيشتغل شوفير عند الرئيس المخلوع.. بيسوق له العربيه..!! هو ده اللي باع أراضي البلد ..و مطاراته.. و طياراته لأولاد سيده ..و نسايبهم ..هوا ده اللي مش بعيد لما يمسك يعفي عن سجين زندا الطبي.. ويعين ابنه نائب ليه ..!! و يعيد الفساد اللي كان .. دا بعيد عن شنبه..؟! مع انه البعيد مالوش شنب..!!

و واحد تاني فل من الفلول .. و كان مسؤول كبير في نظام كله فساد .. واستبداد.. وعامل فيها بريء.. و مناضل .. و واخد رمز الشمس ..حتى الرموز ياجدعان فيها خيار وفقوس.. قال إيه هوا الشمس المنيره اللي هتنور البلد..؟! يعني هوا احنا لسه ناقصين فراعين ..؟! واللي تحسبه موسى يطلع فرعون..!!

و واحد رمز الحصان.. يعني هوا أحنا ماصدقنا خلصنا من الجمل ..بعد موقعة الجمل.. يقوم يطلعلنا الحصان ..!! إحنا مش عاوزين رئيس يتركب .. ولا يركب على الشعب..!! إحنا عاوزين رئيس خيّال.. فارس بحق و حقيق.. يقول كلمة الحق .. ولو على رقبته.. و يعرف ربنا ..و يصون العهد و ينهض بالبلد من كبوتها..وميقلناش لكل جواد كبوه..!!

و واحد رمز الساعه .. يمكن كان أبوه بيشتغل قبل كده ساعاتي..!! أهو ده اللي هيمشي البلد زي الساعه .. ويخلي اللي تحتيه يمشوا على العجين مايخلبطهوش .. و هيحكم بالعدل.. بس المشكله في الكفيل اللي في الخليج ..!! ياتري هيديله تسريح..؟! ولا هيحجز عنده الباسبور..!! و لو نجح هيحكم مصر من هناك..؟! ولا في أوقات الأجازات..!!

و واحد رمز الميزان .. دا كلام تمام .. و موزون..!! بس ياتري مين المقصود ..؟! هوا ولا اللي كان عليه العين .. و القصد والنيه..؟! وياتري هيحكم بالتبعيه....؟! وهيدي البيعه من تحت لتحت لمرشد الجمعيه التعاونيه..!! بتاعة الزيت والسكر والرز و المكرونه و الشعريه .. صحيح إن له في الميزان مآرب أخرى..!!

و واحد رمز الشجره .. أهو ده الوحيد فيهم اللي زغنطط .. و ابن من ابناء الثوره.. لكن إيش تعمل يا صعلوق بين الحيتان والفلول.. واللي زي الغول ..واللي كان مسؤول.. واللي مسنود ..واللي ملطوط ..واللي ضربه السلك وافتكر نفسه فطوط ..!! روح يابني شوفلك شغلانه تانيه.. فطريقك مسدود ..مسدود..!!

واللي رمزه الهرم.. و قد هَرِم.. وهو بيحاول يبقى زي الملوك .. وبيقول انا طول عمري اشتراكي ..و أكبر حاجه اشترك فيها ..جمعيه بربعميت جنيه.. أو عمل أبونيه في السكه الحديد.. أيييوه (بالأسكندراني) هقول إيه ولا أيه..؟! منقدرش نعيش في الماضي يابيه.. جدودنا هما اللي فعلاً بنوا الهرم .. واحنا اللي فككناه ..و بعناه حته حته..!! و اقصى حاجه عملناها ..إننا خرمنا التعريفه ..و بعدها الربع جنيه..!!

و آخر واحد رمز النسر.. عاوز يعيد النسر مكانه .. و يرجّع ناصر لزمانه.. بقوله صعب لكل أوان أوانه.. جربنا نقلد غيرنا ..و منفعناش ..و رحنا في أبو بلاش..!! ياريت متعيطش على إللي راح .. و تعيد الجراح .. خلينا نبص لقدام .. نبني بكره.. نعيش في سلام و أمان.. راضيين و حامدين ربنا و شاكرين .. متعملش فيها لوحدك صلاح الدين.. هتلاقي كل اللي حواليك خاينين.. و هتتوكس فيها ..زي سبعه وستين.. وهتجرنا لحرب وهم وطين ..وهتضيّع مصر.. زي ماضاعت فلسطين..؟!

أعتقد لو أن هنداوي باع أرضه وإشترى ثلاثين الف توكيل وإختار رمز الدولار ...لكان مرشحا رئاسيا للخلافة ونافس أردوخان عليها ....للأسف رغم أن الرموز تتحكم فيها ما تحت الطاولات ...إلا إني وحسب تجارب سابقة أقول أن من إختار الحصان والنسر كان يهدف لفوزهما وليس إختيارا ( صدفة ) كما يعتقد البعض
على فكرة أنا إخترت رمز الديك لمن إختار رمز الحصان
ورمز النعامة لمن إختار رمز النسر
أعتقد أن هكذا يمكن وصفهما وبطريقة أدق
</i>

اسماعيل الناطور
05-16-2012, 09:43 AM
أحدث اسـتطلاعات الرأي: «موسى» يتخلى عن المقدمة لـ«شفيق» و«أبوالفتوح» الثالث

http://www.almasryalyoum.com//sites/default/files/imagecache/highslide_zoom/photo/2012/05/15/80371/100.jpg (http://www.almasryalyoum.com/node/842911)

تباينت انعكاسات وتأثيرات الحملات الإعلانية لمرشحى الرئاسة سواء من خلال ظهورهم فى البرامج التليفزيونية والإذاعية، أو المناظرة كما حدث مع عمرو موسى وعبدالمنعم أبوالفتوح، أو من خلال المؤتمرات التى ينظمها مسؤولو الحملات للمرشحين، ولم تنجح تلك الحملات فى تقليص نسب من لم يحسم أمره فى اختيار مرشحه، بل ظلت هذه النسبة عند نفس مستوياتها تقريباً، كما أظهرت نتائج استطلاع الرأى العام للأسبوع الخامس والذى أجراه المركز المصرى لبحوث الرأى العام «بصيرة» بالتعاون مع مؤسسة «المصرى اليوم».

اسماعيل الناطور
05-16-2012, 01:32 PM
في اليوم الأول لإستفتاء بوابة أخبار اليوم :

شفيق يتقدم على منافسيه بنسبة 47 % من الأصوات


أظهرت المؤشرات الأولى لاستطلاع الرأي الذي طرحته بوابة أخبار اليوم في يومه الأول عن تفوق الفريق أحمد شفيق مرشح الرئاسة و استحواذه على النسبة الأكبر من الأصوات.

حصل شفيق على نسبة 47 % من إجمالي الأصوات في حين حصل عمرو موسى أقرب المنافسين له في الاستطلاع على نسبة 17 % .

و تساوى كل من الدكتور عبد المنعم أبو الفتوح و حمدين صباحي و محمد مرسى في عدد الأصوات و التي جاءت نسبتها 11 % لكل منهم في حين حصل باقي المرشحين على نسبة 3 % مجتمعين.

يذكر أن بوابة أخبار اليوم طرحت الاستفتاء قبل أسبوع من بدء المارثون الانتخابي و الذي يبدأ يوم 23 من الشهر الجاري.

يذكر ان باب التصويت في الإستفتاء سيغلق مساء 21 مايو 2012 و تعلن النتيجة النهائية للإستفتاء يوم 22 مايو 2012

اسماعيل الناطور
05-17-2012, 12:53 PM
لم يتعرف كثيرا من الناس على أحمد شفيق - أحد المرشحين لمنصب الرئيس - إلا في أعقاب إندلاع ثورة يناير ، عندما اختاره الرئيس المخلوع حسني مبارك ليكون رئيسا للوزراء أملا في امتصاص الغضب الشعبي الجارف وقتئذ ، إلا أن الثوار رفضوه ، ثم أسقوطه بعد ذلك عندما ثبت أنه ليس أهلا لرئاسة حكومة مصر على ضوء أهداف الثورة ومتطلباتها .
واليوم يطل علينا هذا الرجل ببجاحة لا تقل عن بجاحه عمر سليمان فيرشح نفسه ، مؤيدا في هذا الصدد برجال المجلس العسكري وبكثير من وزراء الحكومة الحالية ، ومؤيدا أيضا بكل جماعات أبناء مبارك وآسفين يا ريس ومن عرفوا بحزب الكنبة أو حزب الأغلبية الصامتة ، وغالبية الفنانين والفنانات والراقصين والراقصات ولاعبي الكرة واللاعبات والمتسلقة على جثث شهداء الثورة ومصابيها ، وغيرهم ممن أضيروا من الثورة وراحوا يبكون على مبارك وأيامه وعلى فساده الذي كانوا يرتعون فيه حتى الثمالة ، بل ومؤيدا من قبل جميع القابعين خلف سجن طرة الطامعين في إنقاذه لهم بعد ذلك ، وقرأت أن تعليمات من داخل السجن صدرت من قبل جمال مبارك وأحمد عز إلي كوادرأمانة السياسات بالحزب الوطني المنحل ورجال أعمال حسني مبارك بالوقوف خلف حملة أحمد شفيق ودعمه ، وآية ذلك المؤتمر الجماهيرى الذى عقده بنادى سوهاج الرياضي بحضور عدد كبير من قيادات وأعضاء ونواب الشعب والشورى السابقين عن الحزب الوطنى المنحل ، وكذا المؤتمر الصحفي الذي عقده بأحد فنادق مدينة 6 أكتوبر بحضور رجل الأعمال أحمد بهجت المعروف بأنه أحد رجالات النظام السابق .
ولأنني أرفض ترشيح هذا الشخص لمجرد أنه كان وزيرا للطيران تحت رئاسة أسوأ رئيس وزراء تولى حكومة مصر هو السيد أحمد نظيف ، وأنه كان واحدا من كبار مهندسى مخطط التوريث ، وصديقا حميما لرجل الأعمال الهارب حسين سالم ، وأنه من ثم أحد الفاسدين الذين كانوا ضمن منظومة متكاملة من الفساد ، وعضو من أعضاء عصابة كبيرة كانت تتولى نهب خيرات مصر بمنهجية وحرفية واضحة على حساب السواد الأعظم من الشعب ، وكان من المقربين لحسني مبارك والمتعاطفين معه أثناء الثورة ، وأن مبارك ما كان يقرب أحدا إليه إلا أذا كان من الفاسدين ، وأنه تعامل مع الثورة باستخفاف كاستخفاف أي حكومة فاسدة إذا ما بدأت شرارة الثورات تشتعل ضدها ، وأنه مسئول سياسيا على أقل تقدير عن أحداث موقعة الجمل بوصفه كان وقتها رئيسا للوزراء ، ووعد قبلها بليلة واحدة بتقديم بنوبون وشكولات للثوار قائلا بسخرية واستهزاء " كأنهم فى الهايد بارك و ممكن أجيب لهم بونبون كمان " ، وأن فوزه بحكم مصر يعني ردة إلى الوراء كثيرا وعودة إلى نظام حسني مبارك القمعي ، خاصة وأنني سمعته بنفسي في أحد برامج التوك شو يجيب على سؤال عن موقفه إذا خرج بعض الشعب إلى الميدان إعتراضا عن فوزه في الإنتخابات ، فأجاب بصرامة وحزم بما مفاده أن الجيش قادر على وأد أي خروج عليه في دقائق معدودة .
فقد بحثت في بعض مخالفاته وشبهات الفساد التي تحوم حوله ، كي أقدم بعض الأدلة لمن يحلو لهم - دفاعا عن المذكور - إتهامنا بالتجني عليه ، فوجدت الأتي :-
1- نشرت صحيفة "صوت الأمة " المصرية بتاريخ 7-9-2011 – قبل أن يعلن هذا المتبجح ترشحه للرئاسة - ما قالت إنها مستندات جديدة تؤكد تورطه في عمليات إسناد بالأمر المباشر لشركة هولندية تكلفت 300 مليون دولار بما يعادل 1.6 مليار جنيه مصري ، في مشروع مبنى الركاب الدولي 3 وهي التهمة المنظورة بالبلاغ رقم 4741 لسنة 2011 ، وقد بدأت تلك الفضيحة - حسب الشكاوى التي قدمها الفنيين والمتخصصين بوزارة الطيران - عندما أصدر أوامره بعمل إصلاحات وتعديلات كبيرة جدا بالمبنى كلفت الدولة الكثير ، رغم أن حجم الحركة الجوية بمصر لا تتطلب مثل هذا المبنى الضخم ، ولم يقم بإجراء مناقصة دولية - حسبما ينص قانون المناقصات والمزايدات - رغم أن تمويل المشروع جاء بقروض من البنك الدولي ، بل سارع إلى التصديق على منح تنفيذ المشروع إلى شركتي إستشاري المطارات الهولندية وشركة جماعة المهندسين الإستشاريين شركة مساهمة مصرية ، وهو ما يطرح علامات استفهام حول منح هذه الامتيازات لشركات بعينها !! .
2- قيامه ببيع 300 ألف مترا من الأراضي الكائنة بزمام وزارة الطيران المدني لرجل الأعمال فهد الشبكشي بسعر جنيه واحد للمتر ، و300 ألف متر لرجل الأعمال وجدي كرارة بسعر جنيه واحد للمتر ، و4 آلاف متر لشركة مورتيل العالمية ، ومنحه حق استغلال فندقين بمارينا للأخير مقابل مليون جنيه سنويًّا رغم أن الفندقين يحققان أرباحا تتراوح ما بين 50 إلى 60 مليون جنيه سنويا .
3- قيامه ببيع عدد من طائرات مصر للطيران ومجيئه بطائرات مستأجرة ، ووضع الشركة في مأزق تدبير الإيجار الشهري ليتباهي بأنه زاد عدد الطائرات بينما هو في الحقيقة قلص أصول الشركة ، كما كانت الحالة الفنية للطائرات المصرية في عهده سيئة لدرجة أنه ولأول مرة فى تاريخ مصر كادت تمنع طائرات مصر من الهبوط في المطارات الأوربية .
4- تحوم الكثير من الشبهات حوله فيما يتعلق بمحاباة معارفه ، حيث قام بترسية مناقصات العديد من الأعمال الإنشائية بالمطار الجديد والتجديدات بالمبنى رقم 2 بالأمر المباشر على أصدقائه ، وبالذات على مجدى راسخ حما علاء مبارك و محمود الجمال حما جمال مبارك ، فيما قام بتعيين وكيل شركة إيرباص بمصر المهندس حسين مسعود رئيسا للشركة القابضة لمصر للطيران لتسهيل السيطرة على عمولات شراء الطائرات من شركة ايرباص ، وتم في عهده تعيين اللواء عبد السلام حلمى مسئول الحفلات بالقوات الجوية رئيسا لمجلس إدارة مستشفى مصر للطيران ، علما بأن حلمي هذا هو من نظم حفلات زفاف أبناءه ، وقام باسناد حفلات ومؤتمرات ومعارض وزارة الطيران المدني لأشرف حريري زوج ابنة جمال عبد العزيز سكرتير الرئيس السابق حسني مبارك .
ويجزم معارضوه بالدلائل أنه كان يقوم بتعيين أصدقائه وزملائه بالقوات الجوية بمناصب مختلفة بوزارة الطيران و مصر للطيران و خصص لهم مرتبات عالية مما أصاب العاملين الأصليين بالإحباط وعدم الانتماء ، وقام بتعيين ابنة أخت الفنانة غادة عبد الرازق بوظيفة طيار في وقت لم تكن الوزارة بحاجة إليها .
5- قيامه بإنفاق 7 ملايين جنيه تقريبا على هايدي راسخ زوجة علاء مبارك وخديجة الجمال زوجة جمال مبارك لتغطية نفقاتهن في باريس ، وتفننه في تسوية هذه المصروفات علي أنها أمور تخص مصر للطيران ، واعتراض مسئول الرقابة الذي أكد هذه المعلومات حتى وصل الأمر إلى نقل هذا المسئول من عمله ، وتردد الأنباء عن قيامه بتقديم خاتم قيمته 750 ألف جنيه هدية إلى سوزان مبارك من ميزانية تنشيط المبيعات بمصر للطيران .
6- علاقة الوطيدة التي كانت تربطه بوزير الإسكان الأسبق محمد إبراهيم سليمان ، تلك العلاقة التي منحته العديد من المزايا كان أبرزها منحه قطعة أرض بأسعار زهيدة في التجمع الخامس بمنطقة القصور، وقيل أنه يمتلك منزلين آخرين في المنطقة عينها إضافة إلى قصر بمارينا ومنزل بالعاصمة الفرنسية باريس .
7- شبهة تورطه هو وعمرو موسى فى قضية في الطائرة التي سقطت قبالة السواحل الامريكية عام 1999 ، إذ جاء أن وليد البطوطي ابن شقيق جميل البطوطي مساعد الطيار في الطائرة المذكورة ذكر أن الجهات السيادية في الدولة رفضت إعادة التحقيق في القضية لأسباب سياسية ولتواطؤ مسئولين كبارا في الدولة لايزالون موجودون الان بالسلطة ، قيل بعد ذلك أن من بينهم عمرو موسى وأحمد شفيق ومسئولين آخرين
8- وآخر ذلك البلاغ الذي قدمه أول أمس عصام سلطان عضو مجلس الشعب إلى النائب العام بقيامه بصفته رئيسا للجمعية التعاونية لضباط الطيران ببيع قطعة أرض مميزة تبلغ مساحتها 40 ألفا و 238 مترا إلى علاء وجمال مبارك بثمن بخس قدره 75 قرشا فقط للمتر، بينما سعر البيع الحقيقي في ذلك التوقيت كان لايقل عن 8 جنيهات في هذا الوقت على نحو يشكل جريمة إهدار للمال العام ، وفد انضم للبلاغ بعض أساتذة القانون المعروفين

ومعظم هذه البلاغات أمام النيابة العسكرية ونيابة الأموال العامة مازالت تحت التحقيقات – حسبما أعلم -
لكل هذا ولما هو غير معلوم لنا أيضا ، لن ينجح أحمد شفيق بأذن الله تعالى في الفوز بمنصب الرئيس ، لأن فوزه يعني بوضوح أن الثورة فشلت وأنه ما كان من ثمة داع له ، وأن الثورة المضادة نجحت في مسعاها ، وهذا ما لن يرضى عنه جزء كبير وكبير جدا من الشعب .



الأخ عبد العزيز عندما شككت مرة في إنك محامي ...غضبت مني ...والحقيقة ما قدمته من تبريرات تحمل إتهامات بعضها أصبح واضحا إنه تلفيق ...قد يعرضك لتهمة الإدعاء الباطل ..فأنت هنا تقول وتقول بدون سند ...فماذا لو قدم بك أحدهم بلاغا للنائب العام بتهمة وخاصة وأنت تقول إنك محامي ...أي تعي تماما مسئولية هذه السرقات التي تسجلها ...من ناحيتي لا أعترض فليس قاض ولا أحمل معلومات , ولكن عندي عقل ...يقول لو واحد من الألف صحيح ..لما أبقى أحمد شفيق نفسه كمرشح للآن ...ولكن أطمئنك بأن أحمد شفيق لن ينجح إلا إذا مكر الله كان في هذا الإتجاه , الجسم المصري الإنتخابي هو جسم فقير هكذا أراد له مبارك ومن وراء مبارك , لذلك فإن حاجته للسكر والزيت والوظيفة وأحلام النهضة هي أقوى أحيانا من قوة الوعي

اسماعيل الناطور
05-17-2012, 12:56 PM
الأستاذ القدير / عبد العزيز عيد
السلام عليكم ورحمة الله وبركاته
نحن ينطبق علينا المثل القائل " الفاضي يعمل قاضي " فقد تحول الشعب المصري كله إلى جهات إتهام وإدانة ، ولم يعد أحد يلقى بالا بالفرق بينهما مادامت الاتهامات تلقى هكذا من طرف واحد ، مع عدم احترام أو ثقة في القضاء المصري ، لذلك تحولت المنتديات والفضائيات والمقاهي والجلسات العامة والخاصة إلى جهات تحقيق ومحاكم على جميع الدرجات في ظاهرة تنفرض بها مصر وحدها فأصبح الجميع يتحدث في دستورية القوانين من عدمها ، وفي توقعاته للأحكام التي ستصدر ، وهكذا وهكذا امتهنت العدالة في مصر ، في سبيل تشويه سمعة الخصوم السياسيين وهذا أسوأ شىء يمكن أن يصيب مجتمعا في عدالته .. حتى وصل الأمر بنـا إلى ضرب القضاة وسبهم وتكسير أروقة المحاكم وقذفها بالحجارة عندما تصدر الأحكام على غير هوانــا .. وأنا لست مدافعا عن أحد .. ولكن فقط أدافع عن مبدأ المتهم برىء حتى تثبت إدانته ، أدافع عن مبدأ الفصل بين السلطات ، واحترام القضاء ، واحترام حرمة الآخرين مهما بلغت عداوتنا لهم .. كما أدافع عن ضرورة المصالحة الوطنية بين كل أبناء الأمة ، فالكل كان يعمل في ظل الأنظمة المستبدة مجبرا ولايملك الكثير أن يتحول وحده إلى ثوري .. فحتى التيارات الإسلامية كانت تتعامل مع مبارك ونظامه باحترام بل وتعاون علني وسري ، وكانت تعقد الصفقات بينهم .. ولم نسمع من واحد منهم كلمة في حق مبارك اللهم إلا النذر اليسير الذي لايقاس عليه .. ثم إن بعد هذه الاتهامات التي ذكرتها قد تكون انجازات لكن الحقد الوظيفي بين أبناء المؤسسة الواحدة واختلاف وجهات النظر يحولها إلى جرائم ماليه .. المهم وبعيدا عن الشأن الخاص لنحترم القضاء وننتظر كلمته .
تحياتي لك

الكل من الفلول يا باشا ...لذلك أطالب بشطب نسبة‏27%‏ من الشعب المصري وهم العاملين في الدولة دون تعداد أسرهم من زوجات وأولاد من قائمة الذين لهم حق الترشيح أو التصويت لإنهم ببساطة فلول
فقد أعلن الدكتور صفوت النحاس رئيس الجهاز المركزي للتنظيم والإدارة أن وأوضح أن حجم الجهاز الإداري مقارنة بعدد السكان يوجد موظف لكل‏12.7‏ مواطن بينما يقابل هذا العدد في الدول الأخري موظف لكل‏40‏ إلي‏100‏ مواطن‏,‏ ويمثلون نسبة‏27%‏
وإذا أضفنا عليهم فلول من الأحزاب الأخرى مثل الأخوان والتجمع والعمل وكل من كان له عضو في برلمانات مبارك ...تبقى النسبة حوالي 95% من الشعب المصري ...فلول ...أما الخمسة في المائة هم من كانوا خارج مصر , لذلك من حقهم أن يستقدموا رئيسا مثل تونس وليبيا ...كده وإلا إيه على رأي فؤاد المهندس

اسماعيل الناطور
05-17-2012, 03:36 PM
بالفيديو والصور..

المحامى ضحية تعذيب الإخوان:

صفوت حجازى والبلتاجى هم من عذبونى ..صعقوني بالكهرباء “وداسوا” على وجهي بالحذاء

http://onaeg.com/wp-content/uploads/2012/03/wekalet-anba2-ona.png

http://onaeg.com/wp-content/uploads/2012/05/1112.jpg (http://onaeg.com/wp-content/uploads/2012/05/1112.jpg)
روى اسامة كمال المحامي تفاصيل واقعة تعذيبه التي تعرض لها من جانب قيادات جماعة الإخوان المسلمين الدكتور حازم فاروق منصور والدكتور محمد البلتاجي وصفوت حجازي ومحسن راضي وشخص يدعى ابو غزالة إلى جانب صاحب شركة سفير للسياحة.
في البداية قال اسامة ” انا لا أنتمى الى اى جماعة مطلقة لا للاخوان المسلمين او السلفيين او أي حزب نهائيا وانه توجه الى ميدان التحرير فجر اليوم الثاني لموقعة الجمل ولم اكن احمل أي مستندات او اوراق تثبت شخصيتي وكنت بالمنطقة تقريبا من الساعة التاسعة الى العاشرة صباحا بميدان عبد المنعم رياض وفوجئت بمجموعة من الاشخاص قاموا بالاعتداء المبرح علي وقطعوا ملابسي بالكامل واصبت برأسي وجبهتي وحدث نزيف في جبهتي وقام مجموعة اطباء بوضع لصق بلاستر على جبهتي وحملوني حتى مكتب سفير للسفريات بميدان التحرير وكنت في حالة الاغماء وكنت اتعرض لعملية تعذيب شرسة سواء بالصعق بالكهرباء ووضع الكهرباء في اماكن حساسة من جسدي وضربي بالعصي الخشبية والصواعق الكهربائية وقاموا بتكبيل يدي من الخلف بوضع “افيز ” بلاستيك وربط اليدين ببعضها البعض وكنت كلما افيق اتعرض لضرب اخر مبرح حتى ادخل في حالة إغماء أخرى شديدة واثناء إفاقتي رأيت شخص بنظارة وانا نائم على الارض ومكبل اليدين يكلمني ويطلب مني ان اقول له انني تابع لامن الدولة كما قاموا بصعقي بالكهرباء في صدري وبطني وذراعي وموقع الذكورة الى جانب ضربي بالايدي والارجل واسلاك الكهرباء والعصي الخشبية وهم يرددون هذا ضابط امن دولة وكنت اصرخ من شدة الالم والتعذيب واقول لهم انني محامي من طنطا وجئت للمشاركة مع الثورة ولا اعرف احد في الداخلية او في جهه اخرى وظلوا ينكلون بي ويصرون علي تعذيبي وكتبوا على جسمي عبارات مهينة منها ضابط امن دولة كلب النظام ثم اتوا بعدد من الصحفيين والمصورين وقاموا بتصوريي وانا مكبل اليدين وانا مكتوب على صدري وبطني ضابط امن دولة كلب النظام بعد ان جردوني من ملابسي.
وقام شخص يدعى حازم فاروق الذي ظل ينهرني ويعذبني وقال لي” الناس دي متعتها انك تفضل كدا لحد ما تنطق ” وقال لهم ابعدوا عني الكاميرات وانا هخليه ينطق ” وقام بالقفذ عاليا ونزل بكل قوته بركبتيه علي صدري ويقوم بتعذيبي بالصعق بالكهرباء في موقع الذكورة واماكن حساسة في جسدي وفوجئت برجل اخر يجرب شيئا جديدا من التعذيب يدعى الدكتور محمد البلتاجي وقام بضربي برجله في وجهي بل قام بوضع قدميه علي وجهي بحذائه وانا ملقى على الارض واستدعى شخص يدعى ابو غزالة قام برفعي من على الارض وانا مكبل اليدين والقدمين والقاني مرة اخرى على ظهري على الارض بكل قسوة وقام بضربي بعصا خشبية على وجهي وفي انحاء متفرقة من جسدي وكان يتم ذلك التعذيب تحت اشراف صفوت حجازي ومحسن راضي ومحمد البلتاجي وقاموا بعد ذلك بنقلي وتسليمي لاشخاص اخرين مارسوا عليا اشد انواع التعذيب في اماكن مختلفة بعد ان قاموا بوضع عصابة سوداء على عيني حتى لاأرى احد منهم وكنت استغيث بالله منهم ولكن دون رحمة او شفقة.
وسأل شخص كان متواجد عن التليفون الخاص بي وقال ان هذا التليفون به جهاز تصنت حتى يثبتوا اني اعمل في أمن الدولة وظللت لمدة يومين كاملين لم اتناول أي طعام او شراب وعندما قاموا بفك العصابة عن عيني وجدت نفسي داخل مكتب سفريات وبه اجهزة كمبيوتر ولاحظت انه مكتب سفير للسياحة.
اما شقيقه مصطفى موظف بمديرية الاسكان فقال لن نتنازل عن حقنا ولا حق شقيقنا بالقانون او بأي طريقة اخرى ولو ادى الامر الى القتل ويجب ان يعرف الشعب جميعا من هم الاخوان المسلمين وكذب وادعاءات صفوت حجازى وعدوانية حازم فاروق نقيب اطباء الاسنان وحماس وثورة محمد البلتاجي ولابد ان يعرف شعب مصر حقيقتهم قبل الانتخابات الرئاسية ولن ننتظر حتى يأتوا بحازم فاروق وزيرا للداخلية ولا البلتاجي حتى يعيدوا زمن حبيب العادلي مرة اخرى وتجربته.
واضاف باننا لسنا ضد حزب او جماعة ولسنا ضد اشخاص بعينهم وهناك بلاغ مقدم من النائب العام وكل ما يهمنا الحصول على حقنا في تعذيب شقيقنا والتنكيل به وتضمن البلاغ المقدم للنائب العام العديد من صنوف التعذيب التي تعرض لها المجني عليه والتي تم تصوريها وبثها على العديد من المواقع على مستوى العالم منها موقع داي لايف الذي تعرفنا من خلاله ان اسامة كان محتجزا وكان يعذب على يد جماعة الاخوان وقيادتها بالصوت والصورة.

http://onaeg.com/wp-content/uploads/2012/05/66-300x225.jpg
http://onaeg.com/wp-content/uploads/2012/05/55-300x225.jpg (http://onaeg.com/wp-content/uploads/2012/05/55.jpg)
http://onaeg.com/wp-content/uploads/2012/05/0112-168x300.jpg (http://onaeg.com/wp-content/uploads/2012/05/0112.jpg)
http://onaeg.com/wp-content/uploads/2012/05/77-300x225.jpg
http://onaeg.com/wp-content/uploads/2012/05/222-300x215.jpg
http://onaeg.com/wp-content/uploads/2012/05/331-300x195.jpg
http://onaeg.com/wp-content/uploads/2012/05/441-300x225.jpg (http://onaeg.com/wp-content/uploads/2012/05/441.jpg)

أبو صالح
05-17-2012, 03:57 PM
بالنسبة لي حرية الرأي شيء وحرية نشر الخزعبلات شيء آخر وهذا هو الفرق الاساسي بيني وبين محمد شعبان الموجي أو غيره من مثقفي دولة الفلسفة المؤمنين بالديمقراطية
ما هذا النصب والدجل الذي تنشره يا اسماعيل الناطور بلا ذمة ولا ضمير بحجة أن ناقل الكفر ليس بكافر ولذلك أنا أضفت بالتأكيد سيكون مثقف ببغائي ومسبب للفتن ومن يحب تفاصيل في هذا المجال يضغط على الرابط التالي
http://www.arabelites.com/vb/showthread.php?t=13781
نرجع إلى الفضيحة أو الردح السوقي المبتذل الذي نشره اسماعيل الناطور بلا حياء ولا خجل فالعنوان احتوى اسم صفوت حجازي وهنا هي الفضيحة التي تكشف الكذب فصفوت حجازي لم يكن في يوم من الأيام من الإخوان المسلمين
ولكن ماذا يجمع صفوت حجازي ومحمد البلتاجي هو أنهم كانوا من قيادة ميدان التحرير أيام انتفاضة أدوات العولمة في مصر التي أدت إلى خلع محمد حسني مبارك، وإذا عرف السبب بطل العجب وهي مثال عملي آخر على كيفية افتعال نظريّة المؤامرة بكل خسة ودناءة
السؤال لماذا إعادة نشر أكاذيب وافتراءات اعلام محمد حسني مبارك وصفوت الشريف قبل خلعه الآن؟

اسماعيل الناطور
05-19-2012, 11:35 AM
بالفيديو والصور..

المحامى ضحية تعذيب الإخوان:

صفوت حجازى والبلتاجى هم من عذبونى ..صعقوني بالكهرباء “وداسوا” على وجهي بالحذاء

http://onaeg.com/wp-content/uploads/2012/03/wekalet-anba2-ona.png

http://onaeg.com/wp-content/uploads/2012/05/1112.jpg (http://onaeg.com/wp-content/uploads/2012/05/1112.jpg)
روى اسامة كمال المحامي تفاصيل واقعة تعذيبه التي تعرض لها من جانب قيادات جماعة الإخوان المسلمين الدكتور حازم فاروق منصور والدكتور محمد البلتاجي وصفوت حجازي ومحسن راضي وشخص يدعى ابو غزالة إلى جانب صاحب شركة سفير للسياحة.
في البداية قال اسامة ” انا لا أنتمى الى اى جماعة مطلقة لا للاخوان المسلمين او السلفيين او أي حزب نهائيا وانه توجه الى ميدان التحرير فجر اليوم الثاني لموقعة الجمل ولم اكن احمل أي مستندات او اوراق تثبت شخصيتي وكنت بالمنطقة تقريبا من الساعة التاسعة الى العاشرة صباحا بميدان عبد المنعم رياض وفوجئت بمجموعة من الاشخاص قاموا بالاعتداء المبرح علي وقطعوا ملابسي بالكامل واصبت برأسي وجبهتي وحدث نزيف في جبهتي وقام مجموعة اطباء بوضع لصق بلاستر على جبهتي وحملوني حتى مكتب سفير للسفريات بميدان التحرير وكنت في حالة الاغماء وكنت اتعرض لعملية تعذيب شرسة سواء بالصعق بالكهرباء ووضع الكهرباء في اماكن حساسة من جسدي وضربي بالعصي الخشبية والصواعق الكهربائية وقاموا بتكبيل يدي من الخلف بوضع “افيز ” بلاستيك وربط اليدين ببعضها البعض وكنت كلما افيق اتعرض لضرب اخر مبرح حتى ادخل في حالة إغماء أخرى شديدة واثناء إفاقتي رأيت شخص بنظارة وانا نائم على الارض ومكبل اليدين يكلمني ويطلب مني ان اقول له انني تابع لامن الدولة كما قاموا بصعقي بالكهرباء في صدري وبطني وذراعي وموقع الذكورة الى جانب ضربي بالايدي والارجل واسلاك الكهرباء والعصي الخشبية وهم يرددون هذا ضابط امن دولة وكنت اصرخ من شدة الالم والتعذيب واقول لهم انني محامي من طنطا وجئت للمشاركة مع الثورة ولا اعرف احد في الداخلية او في جهه اخرى وظلوا ينكلون بي ويصرون علي تعذيبي وكتبوا على جسمي عبارات مهينة منها ضابط امن دولة كلب النظام ثم اتوا بعدد من الصحفيين والمصورين وقاموا بتصوريي وانا مكبل اليدين وانا مكتوب على صدري وبطني ضابط امن دولة كلب النظام بعد ان جردوني من ملابسي.
وقام شخص يدعى حازم فاروق الذي ظل ينهرني ويعذبني وقال لي” الناس دي متعتها انك تفضل كدا لحد ما تنطق ” وقال لهم ابعدوا عني الكاميرات وانا هخليه ينطق ” وقام بالقفذ عاليا ونزل بكل قوته بركبتيه علي صدري ويقوم بتعذيبي بالصعق بالكهرباء في موقع الذكورة واماكن حساسة في جسدي وفوجئت برجل اخر يجرب شيئا جديدا من التعذيب يدعى الدكتور محمد البلتاجي وقام بضربي برجله في وجهي بل قام بوضع قدميه علي وجهي بحذائه وانا ملقى على الارض واستدعى شخص يدعى ابو غزالة قام برفعي من على الارض وانا مكبل اليدين والقدمين والقاني مرة اخرى على ظهري على الارض بكل قسوة وقام بضربي بعصا خشبية على وجهي وفي انحاء متفرقة من جسدي وكان يتم ذلك التعذيب تحت اشراف صفوت حجازي ومحسن راضي ومحمد البلتاجي وقاموا بعد ذلك بنقلي وتسليمي لاشخاص اخرين مارسوا عليا اشد انواع التعذيب في اماكن مختلفة بعد ان قاموا بوضع عصابة سوداء على عيني حتى لاأرى احد منهم وكنت استغيث بالله منهم ولكن دون رحمة او شفقة.
وسأل شخص كان متواجد عن التليفون الخاص بي وقال ان هذا التليفون به جهاز تصنت حتى يثبتوا اني اعمل في أمن الدولة وظللت لمدة يومين كاملين لم اتناول أي طعام او شراب وعندما قاموا بفك العصابة عن عيني وجدت نفسي داخل مكتب سفريات وبه اجهزة كمبيوتر ولاحظت انه مكتب سفير للسياحة.
اما شقيقه مصطفى موظف بمديرية الاسكان فقال لن نتنازل عن حقنا ولا حق شقيقنا بالقانون او بأي طريقة اخرى ولو ادى الامر الى القتل ويجب ان يعرف الشعب جميعا من هم الاخوان المسلمين وكذب وادعاءات صفوت حجازى وعدوانية حازم فاروق نقيب اطباء الاسنان وحماس وثورة محمد البلتاجي ولابد ان يعرف شعب مصر حقيقتهم قبل الانتخابات الرئاسية ولن ننتظر حتى يأتوا بحازم فاروق وزيرا للداخلية ولا البلتاجي حتى يعيدوا زمن حبيب العادلي مرة اخرى وتجربته.
واضاف باننا لسنا ضد حزب او جماعة ولسنا ضد اشخاص بعينهم وهناك بلاغ مقدم من النائب العام وكل ما يهمنا الحصول على حقنا في تعذيب شقيقنا والتنكيل به وتضمن البلاغ المقدم للنائب العام العديد من صنوف التعذيب التي تعرض لها المجني عليه والتي تم تصوريها وبثها على العديد من المواقع على مستوى العالم منها موقع داي لايف الذي تعرفنا من خلاله ان اسامة كان محتجزا وكان يعذب على يد جماعة الاخوان وقيادتها بالصوت والصورة.

http://onaeg.com/wp-content/uploads/2012/05/66-300x225.jpg
http://onaeg.com/wp-content/uploads/2012/05/55-300x225.jpg (http://onaeg.com/wp-content/uploads/2012/05/55.jpg)
http://onaeg.com/wp-content/uploads/2012/05/0112-168x300.jpg (http://onaeg.com/wp-content/uploads/2012/05/0112.jpg)
http://onaeg.com/wp-content/uploads/2012/05/77-300x225.jpg
http://onaeg.com/wp-content/uploads/2012/05/222-300x215.jpg
http://onaeg.com/wp-content/uploads/2012/05/331-300x195.jpg

http://onaeg.com/wp-content/uploads/2012/05/441-300x225.jpg (http://onaeg.com/wp-content/uploads/2012/05/441.jpg)

قال صفوت حجازي عضو مجلس أمناء الهيئة الشرعية للحقوق والإصلاح أن الإخوان بانتخاب محمد مرسي رئيسا سيكونون قد تمكنوا من السيطرة علي الثلاث سلطات الرئيسية في مصر ليقيموا مشروعهم الإسلامي الكبير.
وأضاف حجازي خلال مؤتمر انتخابي عقدة حزب الحرية والعدالة بمنطقه ابو سليمان بالإسكندرية موجها كلامه للإعلام والليبراليين والعلمانيين علي حد قوله "أيوة عايزين نكوش علي كل حاجة وحناخد كل حاجة"، مشيرا الي أن قمة الديمقراطية هي أن تكون كل السلطات في اتجاه واحد، من أجل أن يبقي هناك استقرار"، مضيفا حتى لا يكون هناك " قط وفأر في البلد".
وأشار حجازي انه بذلك سيكون بداية لحلم الأمم العربية المتحدة والخلافة الإسلامية القوية، موضحا أن الاختلاف هنا بين حلم الناصريين بالوحدة العربية أن الحلم الناصري قائم علي العصبية الجاهلية التي يبغضها الإسلام، مضيفا هل ستقوم النهضة علي المعتقد الشيوعي اليساري أو الليبرالي , كلا ولكن ستقوم بالمشروع الإسلامي الذي يدعمه مرسي.
وأكد حجازي أنه يدعم مرسي تعبدا وتقربا الي الله مشيرا الي انه مطالب أمام الله بأن يقيم شرع الله وان يجاهد من أجل ذلك، مؤكدا أن هذا الجهاد لن يكون بالحصان والرمح ولكن بوسائل العصر الحديث وهي صناديق الانتخابات.
وهاجم حجازي الإعلام واصفا إياه بالمتحيز ضده وضد مرسي والإخوان، مضيفا أن الاعلام الموجود في مصر هو "إعلام هدام".
وأنهي حجازي كلامه مهاجما المجلس العسكري، مؤكدا انه لن يقبل بمحاكمة معتقلي العباسية أمام القضاء العسكري، مطالبا مجلس الشعب بالتدخل في هذا الموضوع ومنهيا حديثه بالهتاف " يسقط يسقط حكم العسكر ".

اسماعيل الناطور
05-19-2012, 12:00 PM
فيلسوف الصراعات الفرنسي برنارد هنري ليفي
http://3.bp.blogspot.com/-0f-kb4CkIs4/TY_NrYH0n3I/AAAAAAAAAHs/heFMdSCV9d4/s320/Bernard-Henri-Levy-arrive-007.jpg

ما هو دور هذا الرجل في ما أطلق عليه الإعلام ....ثورة الجماهير العربية ؟

[/RIGHT]


http://al-mashhad.com/Media/News/2012/4/20/2012-634705191297552807-755.jpg
الفرنسى برنار هنرى يرشح وائل غنيم لجائزة عالمية
ويعتبر ليفي من اشد العنصريين والذي يدافع في كتاباته عن إقامة إسرائيل الكبري.
بدأ برنار نشاطه العنصرى من أفغانستان مرورًا بالبوسنة والهرسك ثم مرورًا بميدان التحرير بمصر كما وصل إلى بنى غازي بليبيا وألقي خطابا فى المتظاهرين الليبيين.
يعد هنرى ليفى من اكبر المعادين للإسلام فهو من دعا فى الصحف البريطانية لاغتصاب المسلمات المرتدين للحجاب بفرنسا، كما ناصر ليفى الثورة السورية ونادى برحيل الأسد والتظاهر ضد سوريا وقيادتها.
كما يقوم في كثير من المناسبات بتوجيه إهانات للقرآن الكريم من خلال إعلانات مدفوعة الأجر.

أبو صالح
05-19-2012, 12:07 PM
امثال اسماعيل الناطور هم من يجب أن يشكرهم على الدعاية التي يعملوها لأمثال هذا المتفلسف الفرنسي الذي من أجل أن يكسب أي شيء حتى لو كان من بيع صور زوجته عارية بلا أي مبادئ ولا أخلاق
ومع ذلك يأتي هنا اسماعيل الناطور ويستغل أي شيء من أجل نفخهم وعمل منهم ذوي امكانيات اسطورية على حساب أمثال د. صفوت حجازي ممن تقدم الصفوف في انتفاضات أدوات العولمة كما تلاحظون في المداخلات الأخيرة؟!!!
أي خسة وأي حقارة وأي دناءة تمثل مثل تصرفات أمثال اسماعيل الناطور؟ من خلال خلط الحابل بالنابل من أجل التشويش للنجاح في تزييف الوعي عن عمد واصرار وترصد

اسماعيل الناطور
05-19-2012, 10:01 PM
قيل أن من يمتلك ملايين أكثر قبل الانتخابات بيوم فيلوح بها ويدفع سيكون هو الفائز
ستشتعل المزايدات وستنتفخ الجيوب ..،
ومن المضحك فعلا أن نستمع من يقول " أن هذه الانتخابات ستجيء معبرة بصدق
عن رغبة الشعب المصري مثل الانتخابات البرلمانية " ..
ياعيني على الكذب المفروض أن نصحح ونقول : ستجيء معبرة عمن يمتلك الملايين
ويرش بقوة ، لأن الكتلة التي ستتحكم في النتيجة هي البسطاء الذين لا يعرفون في السياسة
أكثر من اسم جمال والسادات ومبارك ..، وهؤلاء سهل التأثير عليهم وتوجيههم
فكيف ستكون الانتخابات معبرة عن رغبة صادقة في بلد نصفه أمي ؟؟

إلا بارتفاع أسعار الصوت واستغلال حاجة شعب أصيل فُرضت عليه الظروف الصعبة .

الرموز لمرشحي الرئاسة مضحكة وقد أبدع الدكتور أشرف في سخريته بعنوان الكوميديا الرئاسية ...وعندي سؤال هنا
لماذا هذه الرموز كانت مضحكة ومن كان وراء الإختيار ؟
وهل ممكن أن نكون أكثر واقعية ونختار رموز متوازنة من مجموعة واحدة ...
فمثلا نختار مجموعة الأوراق المالية
فمثلا رمز الدولار ورمز الدينار ورمز الجنية ولا بأس في رمز القرش والمليم

اسماعيل الناطور
05-20-2012, 09:01 AM
لكن تقدم عبد المنعم أبو الفتوح لا يمكن وصفه بأنه إرادة دولية ، فالرجل من وجوه التيار الإسلامي القديمة كما أن مرشح الغرب المفضل هو عمرو موسى وعبد المنعم أبو الفتوح على طرف النقيض معه في معظم الأمور تقريبا
حساباتي وإستنتاجاتي تعتمد أساسا على منطق ...
1-كيف يفكر من يريد أن يخدعك ؟ فتلاحق الفكرة فإن ما وجدت ما يؤيدها بقوة تسجل هذه القرائن
وبناءا عليه هناك الكثير يقول أن عبد المنعم وعمرو موسى وحمدين صباحي ومحمد مرسي هم ثلاث وجوه للوصول لفكرة واحدة ورابع لدعم الفكرة ولكن على طريقة جولات المصارعة بالنقاط
2- مصادر التمويل وإن لم يكن فكمية التمويل والتي يمكن تحديدها من الظهور الإعلامي ومصاريف الاعلانات وعدد الحملات
وبناءا عليه هناك الكثير يقول أن عبد المنعم وعمرو موسى وحمدين صباحي ومحمد مرسي لهم تمويل خارجي ..وهنا الممول لا يدفع من أجل عيون الشعب
3- العلاقات بين أهداف برامج المرشحين
وبناءا عليه هناك مشروع النهضة والذي يقدمه عبد المنعم وعمرو موسى وحمدين صباحي ومحمد مرسي بصور متقاربة وهو مشروع معلن عن مصادره والذي تؤكد أن المطلوب أن يحكم مصر تيار واحد لأكثر من خمسة عشر عاما ...وهنا أتذكر صعود حماس برغبة شعبية وبعد ذلك بقاءها بقوة الحكم
4- العلاقات بين المرشحين أنفسهم وتاريخهم ....وهنا نجد اربع وجوه تختلف ولكن ينطبق عليها نظرية تسمين العجول والتي قد تخدع المراقب ...
وبناءا عليه فعمرو وحمدين وعبد المنعم ثلات وجوه من ثلاث منابع ولكن يجمعهما (( البرادعي ومن خلفه )))
أعتقد أن هناك تيار أحمد شفيق في مقابل الأربعة الآخرين ( عمرو موسى وعبد المنعم ومحمد مرسي وحمدين )
وما الحملة الإعلامية لحمدين وعمرو إلا لسرقة أصوات تيار أحمد شفيق ......
لذلك قد يكون النهائي إما بين أحمد شفيق وعبد المنعم والنجاح طبعا في الاعادة النجاح لعبد المنعم
وأما النهائي بين حمدين وعبد المنعم والنجاح طبعا لعبد المنعم
وأما النهائي بين عمرو وعبد المنعم والنجاح حينها قرار لمن يريد اللعبة أن تكتمل لذلك كانت المناظرة الوحيدة واليتيمة
لذلك نقول مبروك لعبد المنعم ...فهو المرشح الحقيقي للإخوان والغرب والربيع العربي
طبعا هذا إذا كان الحكم هو حكم الصندوق والصوت حرية أو شراء ...
أما إذا جد جديد ...
فهناك قول جديد

أبو صالح
05-20-2012, 11:52 AM
ابو صالح بقلم/ اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=17337 (http://wata1.com/vb/showthread.php?t=17337)
هذا الموضوع لإسماعيل الناطور كممثل عن ثقافة الـ أنا من وجهة نظري، وهو مثال عملي يوضح مثقف دولة الفلسفة واساليبه في تزييف الوعي بخبث لتشويه المقاومة أو كل من يمثل ثقافة الـ نحن عن عمد وقصد وترصد.

[/font]



الشخصية الوقحة
هي شخصية تعتمد الإستفزاز السلبي في تعاملها مع الآخر
بمعنى إنها تحاول إيذاء المشاعر حين التعامل بدلا من الإستفزاز الإيجابي والذي يعتمد على الإستفزاز العقلي
فإن تطور أمرها وترافق مع ضعفها للوصول إلى ما تريد
فإن ضعفها إمام الفشل يتحول إلى الكذب السافر لدرجة إنها تحول كل إسقاطاتها النفسية على الخصم
فتجد إنها تفعل فعل الفراشة التي تحوم حول النار حتى تحرق نفسها
فتخسر المزيد في كل محاولة للنجاح [/center]
من حرق نفسه في هذا الموضوع حتى الآن يا اسماعيل الناطور؟
وهل هناك وقاحة أكثر مما قمت به في هذا الموضوع يا من يظن نفسه بقة
ألا تعلم يا أيُّها السفيه التافه وبوقاحة بلا خجل ولا حياء أنك أنت من افتتح هذا الموضوع، فمن تعدّى على من؟
ما هذا الدجل والنصب والتلفيق والاعتداء على خلق الله بلا أي ضمير ولا أي أخلاق
وكل ذنبهم أنهم قاوموا الظلم والاستعباد والاستبداد وصاحوا الله أكبر يا مجرمين
أنت وكل شلتك ممن يؤمنون بنظرية المؤامرة أتفه من أن تستطيع التمييز بين اسلوبي واسلوب محمد شعبان الموجي، حيث أن أكثر من واحد منكم صرّح وأنت منهم يا اسماعيل الناطور ويسري راغب شراب كان يظن أنني ومحمد شعبان الموجي شخص واحد في الملتقى،
هل هناك أي مجال للشبه بين اسلوب أبو صالح واسلوب محمد شعبان الموجي؟!!! لكي يمكن أن يأتي على بالكم ذلك؟!!!
فأي غباء وأي تحليل وأي سياسة يفهم فيها اسماعيل الناطور أو يسري راغب شراب أو مازن ابو فاشا أو غازية منصور الغجري أو اعيان القيسي أو محمد شعبان الموجي ممن يهاجم انتفاضات أدوات العولمة ويعمل على تجريحها وتشويهها والافتراء عليها من جهة
وتكذيب الجرائم في كل أفعال البلطجية/الشبيحة من جهة أخرى
وأولها ما قمت به أنت يا اسماعيل الناطور في مسألة السجود لصور بشار الأسد عندما نشرها مازن أبو يزن في الملتقى فقمت بتكذيبها في حينها ويا ريت بأي حجة منطقية أو موضوعية بل كلّه دس وتشويه بأكاذيب وافتراءات متعمدة بلا أي ضمير ولا أي أخلاق؟!
أنت طالبت بقتل أهلنا في مصر وسوريا واليمن وليبيا بدم بارد يا مجرم
فهل هناك خيانة وباستهتار أكثر من ذلك يا سفلة ولا حول ولا قوة إلا بالله

اسماعيل الناطور
05-21-2012, 09:40 AM
قال لجهاد الخازن ان الجماعة لبست جاهزه للحكم ومع ذلك ترغب في السيطره وهنا تكمن الخطوره
حذر اللواء عمر سليمان رئيس جهاز المخابرات السابق من تشكيل جماعة الاخوان المسلمين لحرس ثوري لينتهي الامر الي حرب اهليه لاسيما في ظل تزايد فرص حدوث انقلاب عسكري قريبا وذلك طبقا لما قاله ونقله عنه الكاتب الصحفي الكبير والاعلامي جهاد الخازن في مقال له بصحيفة الحياه اللندنيه في عمود عيون واذان
يرى اللواء عمر سليمان، وزير الاستخبارات السابق، ان مصر الثورة تواجه ثلاث مشكلات رئيسية أهمها صعود التيار الديني وامتلاكه شرعية، فالتيار الديني لم تتح له فرصة من قبل ليزاول السياسة أو يفهم المجتمع، وقادته منغلقون على أنفسهم إذا وضعت مصر تحت حكمهم فستعاني كثيراً وقد تصل الى صدام مجتمعي وعنف وخطر حرب أهلية.
كانت لي جلسة مع اللواء في القاهرة زادت على ساعتين، وهي الاولى منذ خروجه من الحكم، ووجدته موسوعياً في معرفته بأمور مصر، كعادته، مع تحليل دقيق، ومساحة أوسع من الحرية في الكلام طالما انه «متقاعد».
قال اللواء عمر سليمان ان اداء البرلمان في الاشهر القليلة الماضية كان سيئاً، اهتم بالقشور، وأصدر قوانين لا تخدم مصلحة الوطن. وهو أبدى قلقه من استمرار هذا الوضع في الاشهر المقبلة، ومن احتمال اصدار قوانين خاصة بالمرأة تجعلها أسيرة بيتها، مع انه توجد حالياً قوانين انصفت المرأة.
التيار الاسلامي في رأيه لا يملك كوادر قادرة على ادارة مؤسسات الدولة، ومع ذلك يريد السيطرة على مقدرات البلاد. وبما ان 40 في المئة من المصريين فقراء فإنه يسهل خداعهم بمساعدات مثل تأمين الولادة لحامل أو تقديم رز وسكر وما الى ذلك من مواد غذائية.
اللواء عمر سليمان كان في مواجهة مع جماعة الاخوان المسلمين في الحكم وخارجه، وهو عندما رشح نفسه للانتخابات ثار الاسلاميون وهددوا بالعنف ادراكاً منهم انه صاحب الحظ الاوفر في الفوز، وأصدروا «قانون عمر سليمان» في اربعة ايام فقط من المناقشة.
هو حذر من صراع مجتمعي اذا انتخب عضو في التيار رئيساً، واشار الى خفض حضانة الطفل ومحاولة خفض سن الزواج للفتيات، وقرارات اخرى تعكس الالتزام الديني لا حاجة المجتمع.والي نص المقال
الرئيس من التيار هو المشكلة الثانية التي يراها اللواء، لأنه سيرأس دولة دينية لم يعرفها المصريون من قبل، وقد تعود جماعات كانت محسوبة علـيـهم في الـمـاضي مثـل الجهاد والـجماعة الاسلامية والـتـكـفـير والـهـجـرة. والمرشح عبدالمـنـعم ابو الفـتـوح انـشـأ الجــماعة الاسـلامـية وهي موجودة الآن وعندها حرية العـمــل التنظيمي. وبما ان الحدود مفتوحة مع ليبيا والسودان فهناك فـرصـة الحصول على السلاح، وهذا سيكون بأيـدي جـماعة تـهدد بالرجوع الى العنـف اذا لم يسر المجتمع كما يريدون.
بكلام آخر، رئيس الاستخبارات السابق، يخشى من وضع يستورد فيه أيمن الظواهري مجموعة من المسلمين المصريين لتصبح مصر في نظر الغرب دولة تصدر الارهاب، ما يهددها بقطع المساعدات وبحصار وعقوبات.
في المقابل، الرئيس الليبرالي سيعاني منهم الا انه يظل قادراً على ان يعمل حكماً بين السلطات، ويوقف أي اتجاه يناهض حرية المجتمع، كما انه سيكون مقبولاً من المجتمع الغربي.
المشكلة الثالثة هي القضية الفلسطينية وانعكاساتها على علاقات مصر مع الولايات المتحدة. واللواء عمر سليمان يرى ان علاقات مصر الاستراتيجية مع الاميركيين مهمة جداً لاستقرار مصر، كما حدث في السابق، وما هو مقبل. اذا ساءت العلاقة «سنبقى ألعن من باكستان وافغانستان، وينظر الينا كبلد يصدر الارهاب، ومن دون قرار سيادي فتخسر دورها ويخسر جيشها الذي تمثل الاسلحة الاميركية 70 في المئة مما لديه، ويضرب الاقتصاد، فهناك 500 مصنع ضمن برنامج كويز (مناطق صناعية عالية المستوى) لتصدير البضائع الى الولايات المتحدة يفترض ان تزيد».
مع كل هذه الـخـلـفـية الاخـوان المـسـلمون يروّجـون لعـدائـهم مـع اميركا لاسـترضاء الشـعب، ويـلـمحون الـى الـغاء معـاهدة الـسـلام مع اسـرائيل.
سألت اللواء عمر سليمان هل يقع انقلاب عسكري؟ قال: ممكن، ممكن جداً. انما الاخوان مش هُبُل، لذلك يعدون أنفسهم عسكرياً، وخلال سنتين أو ثلاث سيكون عندهم حرس ثوري لمحاربة الجيش، وتواجه مصر خطر حرب أهلية مثل العراق

ابو برزان القيسي
05-21-2012, 10:18 AM
http://www.iraqup.com/up/20120521/GLnjJ-s600_963936252.jpg (http://www.iraqup.com/)

اسماعيل الناطور
05-22-2012, 09:31 AM
هذه النقاط أخي إسماعيل تعيدنا إلى البحث في كيفية النظر إلى العمل السياسي ، ورغم أن كثيرا من علماء الإجتماع يعبر عن السياسة على أنها التلخيص العملي للمصالح الإقتصادية ، ورغم أن العقائدية السياسية ( وحتى الدينية منها ) يمكن تأطيرها ضمن المصلحة ( الفردية والمجتمعية ) الإقتصادية ، إلا أن عاملا صغيرا وفرديا بمقدوره أن يترك هذه النظرية معلقة في الهواء وفي أمس الحاجة إلى تعديل ما

هذا العامل هو التأثير الشخصي للزعيم السياسي ، فالبرغم من أن الصفات التي يحملها فرد واحد مقاسة إلى الصفات التي يحملها مجتمع بأكمله هي نسبة تكاد تقترب من الصفر ( في مصر سيكون هناك رئيس واحد مقابل ثمانين مليون مواطن ) ، ومع ذلك ، فإن التاريخ يشرح ببساطة أن دور الفرد القائد يكاد يكون أكبر من دور الملايين المقادة بواسطته ، وأن الفنون ( السياسة ) التي يتبعها هذا القائد في تحقيق قيادته لا يحكم عليها فقط من ناحية الهدف الأصلي وهو تحقيق المصلحة الإقتصادية

بالمناسبة وبعيدا عن سياق الموضوع هنا ، وكي لا أدخل في طبيعة التاريخ الذي يجعل أفرادا بعينهم أصحاب تأثير لآلاف السنوات وكي لا أضع مقارنة قد تضع أفرادا مميزين كالأنبياء والرسل عليهم الصلاة والسلام في مقارنة مع قادة آخرين كالإسكندر وكونفوشيوس وزرادشت وأديسون وهتلر وآينشتاين وغيرهم كثير ، فإن هذه النقطة المتعلقة بالتأثير الفردي للقائد وقدرة هذا الفرد على تحديد مستقبل جماعته ( فإن شقي شقيت معه الملايين وإن سعد سعدت معه ) هي ما جعل الكثير من الأنظمة الإجتماعية منذ فجر التاريخ تحاول الوصول إلى صيغة جماعية للحكم تجعل تأثير الفرد القائد أقل بدرجة أو أخرى ، وعلى الرغم من تعثر التجارب منذ روما وحتى واشنطن في ذلك إلا أن الثابت أن المعيار الإقتصادي هو المعيار الذي تميل الجماعة إلى اتخاذه في شأن تقييم السياسة ، ولهذا يكون العامل الإقتصادي هو السبب الرئيس في أي ثورة ، بما فيها الثورات العلمية والإجتماعية

بالعودة إلى النقاط التي طرحتها هنا ، والتي تذكرني بحوار قديم مع أحد الأخوة حول تدني سعر الصوت الإنتخابي ( مع أن العملية التي تتم الآن في مصر هي تصويت وليس إنتخاب ) فإن ما قلته حول تأثير المال السياسي صحيح ، وقد يختلف البعض حول مشروعيته أو عدم مشروعيته ، ولكن الأمر الذي يجب تجنبه بكل الأشكال هو تحويل هذا التأثير لمصلحة مخالفة للمصلحة المصرية ، وأهم هذه المصالح هي المصلحة الإقتصادية ، فإذا ما أدرك الرئيس القادم أن دوره هو تحقيق الحل الإقتصادي كأساس متين لأي بناء مستقبلي لمصر ( ومن بعدها العالم العربي ) يمكن عندها تصور تداول مستقبلي آخر للسلطة يأتي برئيس آخر قادر على إكمال المشروع عبر بناء أدوار (طوابق) على هذا الأساس ، إما إذا تكررت تجربة عبد الناصر بحرفيتها ، فإن الأزمة ستستمر والثورة على النظام ستأتي طال الزمن أو قصر ، فلقد أدت طموحات عبد الناصر ومزاياه الشخصية وقدرته على التأثير على جماهير يزيد عددها على عدد مواطني دولته بعدة مرات إلى تشكل وجهة نظر متعجلة في معظم تحركاته ، صحيح أنه قدم لمصر الكثير ، لكن تصوراته حول قوة المجتمع آنذاك كانت أكبر من قدرات المجتمع الفعلية ، ولهذا السبب فقد قام بالتوجه نحو جبهات كثيرة بأكثر مما تتحمله السفينة التي تحمله وكذلك بأكثر مما يتحمله جسده هو

قلت كل ما سبق كي أصل إلى نقطة هامة جدا وأراها ضرورية جدا ، فلو افترضنا أن كل المرشحين دون استثناء هم مرشحوا التحالف الغربي-الصهيوني-النفطي ( مع أنه واضح تقاسم الأدوار فيما بين أجزاء هذا التحالف ومرشح كل قسم منه بات معروفا ) ، وأن المال السياسي قد أدى إلى فوز هذا أو ذاك ، فإن أهم ما يلزم هذا الرئيس القادم هو التفاف باقي المرشحين معه والدفاع عنه والوصول معه إلى برنامج أساسي هو بناء الإقتصاد أولا وترك الملفات الأخرى لوقت آخر مرتبط بمدى التقدم في الوضع الإقتصادي ، هذا لا يعني أن ينحني الرئيس القادم أمام مموليه ، بل إن وقوف الجميع مع الرئيس القادم سيعني تخلصه تماما من تبعة المال السياسي ، كما لا يعني أن هذا الرئيس سواجه مساندة من مموليه الحاليين ، بل على العكس ، فأيا كان الرئيس القادم فإنه سيواجه حربا إقتصادية عبر القروض وفوائدها والمساعدات العسكرية والمالية ، وحربا مائية عبر حصار منابع النيل وتقويض الإنتاج الزراعي ، وحربا أمنية عبر السلاح المتدفق إلى مصر من كل الجهات والمفخخات الدينية المتنقلة عبر الكنائس والملاعب الرياضية ، وحربا إعلامية عبر الفضائيات ( لا تستغرب أن تخرج راقصة قريبا لتدعي أن الرئيس المنتخب قد اعتدى عليها أو يخرج رجل أعمال ليعترف بأن الرئيس المنتخب قد قبض منه رشى في حملته الإنتخابية أو داعية دينيا يتهمه بالكفر وهدم الشريعة ) ، وكل هذا ولما نصل إلى بعد إلى الحرب العسكرية التي يطمح الغرب فيها أن يجعل الدم المصري يسيل على كثبان الصحراء في الحرب المقدسة دفاعا عن "أهل الذمة" في تل أبيب تجاه المد "الصفوي الشيوعي الشيعي القرمطي المجوسي الزاردشتي الكافر الملحد عدو البشرية جمعاء"

أعلم مسبقا أن هذا الكلام يبدو وكأنه إعادة لمرحلة السادات ، أو أنه تسويغ لإبتعاد مصر عن الشأن السياسي الخارجي ، أو دعوة لبقاء الموقف من القضية الفلسطينية كما هي ، أو انتظار هطول الفراخ التي لما تأت بعد مع كامب ديفيد ، أو أو أو ، لكن القصد الحقيقي منه هو غير ذلك ، وأظن أن حواراتنا السابقة تكفي كي لا أعيد التأكيد عليها

بطبيعة الحال لا أستطيع أن أتصور أو حتى أتخيل أن فوز عمرو موسى ( مثلا ) هو فوز طبيعي ويأتي في سياق الثورة ، ولكن على الأقل ليس بوسعه تدمير مصر بأكثر مما فعلت كامب ديفيد التي أوصلت البلاد إلى ما لم يكن بوسع مناحيم بيجن أن يوصلها إليه لو كان هو رئيسها ، فلو حدث هذا الكابوس ، فعلى الباقيين أن يقفوا معه وأن يدافعوا عنه وأن يقنعوه بأن يكون هناك ملفا واحدا على طاولته هو الملف الإقتصادي وأن الغرب مثل الشيطان لا يأتي منه الخير أبدا ، ولنا في هذا الغرب عبرة عندما فاز أولاند على ساركوزي الذي كان قبل ساعات من فوزه يذكره برشوة القذافي له ، فإذا به بعد فوزه ، وبفارق بسيط ، يقر له ويهنئه ويتمنى له التوفيق ، ويتحد معه في خدمة فرنسا

تحياتي أخي إسماعيل وأرجو أن لا أكون قد أطلت عليك





بالعودة إلى النقاط التي طرحتها هنا ، والتي تذكرني بحوار قديم مع أحد الأخوة حول تدني سعر الصوت الإنتخابي ( مع أن العملية التي تتم الآن في مصر هي تصويت وليس إنتخاب ) فإن ما قلته حول تأثير المال السياسي صحيح ، وقد يختلف البعض حول مشروعيته أو عدم مشروعيته ، ولكن الأمر الذي يجب تجنبه بكل الأشكال هو تحويل هذا التأثير لمصلحة مخالفة للمصلحة المصرية ، وأهم هذه المصالح هي المصلحة الإقتصادية ،
نغش القارئ عندما نفترض حسن النية في إختيار الرئيس , لأن هذا الإختيار لم يأت على قاعدة تداول السلطة ومناخ الديمقراطية , نعلم تماما أن الانتخاب يأتي بعد تغيير فوضوي تتضح فيه الخيوط الخارجية ولأهداف ومخططات ليس من ضمنها القضية الإقتصادية العربية ولا النهضة العربية , لذلك أن نناقش الأمر تحت صيغة أن المرشح جاء وقد يحول دعمه ومن يدعمه من أجل مصالح إقتصادية وطنية , هو أخذ القارئ مرة أخرى إلى مناخ تسويق كامب ديفيد , الربيع العربي جاء بهدف التقسيم والتفتيت , ومن لا يريد أن يصدق فعليه أن ينتظر ,الهدف في مصر على الأقل هو القضاء على الجيش المصري , لتحويل مصر إلى دولة تنقسم ذاتيا ...بإستغلال شعارات الحرية والديمقراطية أو إستغلال حاجة الناس وفقرهم فعلى سبيل المثال تقوم حملة المرشح الإنتخابى عمرو موسى حالياً بدعوة المصريين الى منصارة عمرو موسى فى يوم الإنتخابات والدخول فى حملات الدعاية الإنتخابية له مقابل وجبة غداء و70 جنيهاً وايضاً مواصلاتهم الخاصة .والتيارات الإسلامية تستغل الدين والفقر معا , وحمدين يستغل الدين بإخافة الناس منه لذلك يلتف حوله كل ما أراد حرية بدون دين ...وهكذا .....ودعني أقولها بصراحة ...لو كنت في مكان قادة القوات المسلحة المصرية ...فلن أضع مقدرات الدولة في يد أي رئيس منتخب في هذا الوضع وبهذه الطريقة ...وسأترك له فترة من الزمن إلى أن يتعلم فن القيادة , ويشعر القاصي والداني أن من يحكم الناس جاء من أجل الناس , فمصير الشعوب ليس ساحة تجارب ولقمة العيش والأمن وإحترام الوطن والمواطن هما هدف الحكم , أتمنى أن يسود الوعي على كل صاحب صوت إنتخابي لأن الله وهو نفسه سيحاسب نفسه إن باع صوته بمال .....الوطن غالي يامن لا تدركون معنى الوطن ...

أبو صالح
05-22-2012, 10:45 AM
ثورة الحمير بقلم اسماعيل الناطور
رئيس على واحدة ونص بقلم اسماعيل الناطور
نغش القارئ عندما نفترض حسن النية في إختيار الرئيس , لأن هذا الإختيار لم يأت على قاعدة تداول السلطة ومناخ الديمقراطية , نعلم تماما أن الانتخاب يأتي بعد تغيير فوضوي تتضح فيه الخيوط الخارجية ولأهداف ومخططات ليس من ضمنها القضية الإقتصادية العربية ولا النهضة العربية , لذلك أن نناقش الأمر تحت صيغة أن المرشح جاء وقد يحول دعمه ومن يدعمه من أجل مصالح إقتصادية وطنية , هو أخذ القارئ مرة أخرى إلى مناخ تسويق كامب ديفيد , الربيع العربي جاء بهدف التقسيم والتفتيت , ومن لا يريد أن يصدق فعليه أن ينتظر ,الهدف في مصر على الأقل هو القضاء على الجيش المصري , لتحويل مصر إلى دولة تنقسم ذاتيا ...بإستغلال شعارات الحرية والديمقراطية أو إستغلال حاجة الناس وفقرهم فعلى سبيل المثال تقوم حملة المرشح الإنتخابى عمرو موسى حالياً بدعوة المصريين الى منصارة عمرو موسى فى يوم الإنتخابات والدخول فى حملات الدعاية الإنتخابية له مقابل وجبة غداء و70 جنيهاً وايضاً مواصلاتهم الخاصة .والتيارات الإسلامية تستغل الدين والفقر معا , وحمدين يستغل الدين بإخافة الناس منه لذلك يلتف حوله كل ما أراد حرية بدون دين ...وهكذا .....ودعني أقولها بصراحة ...لو كنت في مكان قادة القوات المسلحة المصرية ...فلن أضع مقدرات الدولة في يد أي رئيس منتخب في هذا الوضع وبهذه الطريقة ...وسأترك له فترة من الزمن إلى أن يتعلم فن القيادة , ويشعر القاصي والداني أن من يحكم الناس جاء من أجل الناس , فمصير الشعوب ليس ساحة تجارب ولقمة العيش والأمن وإحترام الوطن والمواطن هما هدف الحكم , أتمنى أن يسود الوعي على كل صاحب صوت إنتخابي لأن الله وهو نفسه سيحاسب نفسه إن باع صوته بمال .....الوطن غالي يامن لا تدركون معنى الوطن ...
-----------------------

ما هذا الكفر الصريح بالله وأي معنى وأي وطن وأي بطيخ يا اسماعيل الناطور أصح يا جاهل
إن لم تكن زنديقا فمن المنطقي والموضوعي كل من يدعي بأنه يعلم بالنيّات فهو دجال ونصاب لأن الله سبحانه وتعالى قال لا يعلم بالنيات إلاّ الله
فكيف الحال بمن يعمل من نفسه قاضي ويصدر أحكام لتشويه السمعة والذمة والأخلاق والمطالبة بقتل ناس وتدمير بلد بالإنقلاب على نتيجة الانتخابات إن لم تدخل النتائج مزاجهم،
كما يفعل اصحاب نظرية المؤامرة المشركين بالله بكل وضوح كما توضحها طريقة الصياغة والتي لونتها باللون الأحمر من مداخلتك يا اسماعيل الناطور؟!!!
حيث أن اسلوب التأويل الفاسد من خلال أن يأتي على شيء أبيض يدعي أنّه اسود ومن ثم يصدر فتواه على اللون الأسود؟!! ولكن هذا لن يجعل اللون الأبيض أصبح أسودا ولا أن يكون لفتواه أي درجة من الصحّة، وهنا يخطر لي السؤال التالي
لماذا ثقافة الـ أنا أو الفلسفة أو علم الكلام تحارب الأخلاق أو ثقافة الـ نحن أو الدين أو الله ولذلك لا يمكن أن تكون اساس لأي حوار للتعايش؟ فالفشل سيكون حليفها دوما، وهو ما أناقشه في الرابط التالي
http://wata1.com/vb/showthread.php?t=17363 (http://wata1.com/vb/showthread.php?t=17363)
ما رأيكم دام فضلكم؟

اسماعيل الناطور
05-23-2012, 10:08 AM
[/size][/font]
نغش القارئ عندما نفترض حسن النية في إختيار الرئيس , لأن هذا الإختيار لم يأت على قاعدة تداول السلطة ومناخ الديمقراطية , نعلم تماما أن الانتخاب يأتي بعد تغيير فوضوي تتضح فيه الخيوط الخارجية ولأهداف ومخططات ليس من ضمنها القضية الإقتصادية العربية ولا النهضة العربية , لذلك أن نناقش الأمر تحت صيغة أن المرشح جاء وقد يحول دعمه ومن يدعمه من أجل مصالح إقتصادية وطنية , هو أخذ القارئ مرة أخرى إلى مناخ تسويق كامب ديفيد , الربيع العربي جاء بهدف التقسيم والتفتيت , ومن لا يريد أن يصدق فعليه أن ينتظر ,الهدف في مصر على الأقل هو القضاء على الجيش المصري , لتحويل مصر إلى دولة تنقسم ذاتيا ...بإستغلال شعارات الحرية والديمقراطية أو إستغلال حاجة الناس وفقرهم فعلى سبيل المثال تقوم حملة المرشح الإنتخابى عمرو موسى حالياً بدعوة المصريين الى منصارة عمرو موسى فى يوم الإنتخابات والدخول فى حملات الدعاية الإنتخابية له مقابل وجبة غداء و70 جنيهاً وايضاً مواصلاتهم الخاصة .والتيارات الإسلامية تستغل الدين والفقر معا , وحمدين يستغل الدين بإخافة الناس منه لذلك يلتف حوله كل ما أراد حرية بدون دين ...وهكذا .....ودعني أقولها بصراحة ...لو كنت في مكان قادة القوات المسلحة المصرية ...فلن أضع مقدرات الدولة في يد أي رئيس منتخب في هذا الوضع وبهذه الطريقة ...وسأترك له فترة من الزمن إلى أن يتعلم فن القيادة , ويشعر القاصي والداني أن من يحكم الناس جاء من أجل الناس , فمصير الشعوب ليس ساحة تجارب ولقمة العيش والأمن وإحترام الوطن والمواطن هما هدف الحكم , أتمنى أن يسود الوعي على كل صاحب صوت إنتخابي لأن الله وهو نفسه سيحاسب نفسه إن باع صوته بمال .....الوطن غالي يامن لا تدركون معنى الوطن ...



اليوم إنتخاب......وغدا أمر
فهل تعود مصر بسليم العوا أو أحمد شفيق إلى شخصية مصر العربية الاسلامية الرائدة القائدة
أم تعود مصر بباقي الأحد عشر دولة ذنب بدون شخصية ولا إرادة , ارض للتجارب والمخططات

اسماعيل الناطور
05-23-2012, 10:34 AM
هنا إحصائية ظريفة من واقع مواضيعي المتعلقة بانتخابات الرئاسية
1-سلسلة نقاش مرشح رئاسي(4) عمر سليمان (http://www.almolltaqa.com/ib/showthread.php?96591-سلسلة-نقاش-مرشح-رئاسي(4)-عمر-سليمان) عدد الزوار 585
2-سلسلة نقاش مرشح رئاسي(2) خيرت الشاطر (http://www.almolltaqa.com/ib/showthread.php?96475-سلسلة-نقاش-مرشح-رئاسي(2)-خيرت-الشاطر) عدد الزوار 433
3-سلسلة نقاش مرشح رئاسي(7) عبد المنعم ابو الفتوح (http://www.almolltaqa.com/ib/showthread.php?96671-سلسلة-نقاش-مرشح-رئاسي(7)-عبد-المنعم-ابو-الفتوح) عدد الزوار 294
4-سلسلة نقاش مرشح رئاسي ( 6) حمدين صباحي (http://www.almolltaqa.com/ib/showthread.php?96665-سلسلة-نقاش-مرشح-رئاسي-(-6)-حمدين-صباحي) عدد الزوار 281
5-سلسلة نقاش مرشح رئاسي(8) أحمد شفيق (http://www.almolltaqa.com/ib/showthread.php?96672-سلسلة-نقاش-مرشح-رئاسي(8)-أحمد-شفيق) عدد الزوار 203
6-سلسلة نقاش مرشح رئاسي(1) صلاح حازم ابو اسماعيل (http://www.almolltaqa.com/ib/showthread.php?96462-سلسلة-نقاش-مرشح-رئاسي(1)-صلاح-حازم-ابو-اسماعيل) عدد الزوار 162
7- سلسلة نقاش مرشح رئاسي(5) محمد سليم العوا (http://www.almolltaqa.com/ib/showthread.php?96662-سلسلة-نقاش-مرشح-رئاسي(5)-محمد-سليم-العوا) عدد الزوار 160
8- سلسلة نقاش مرشح رئاسي(3) عمرو موسى (http://www.almolltaqa.com/ib/showthread.php?96550-سلسلة-نقاش-مرشح-رئاسي(3)-عمرو-موسى) عدد الزوار 123
9-سلسلة نقاش مرشح رئاسي(9-23) ...لماذا رشحوا أنفسهم ؟ (http://www.almolltaqa.com/ib/showthread.php?96696-سلسلة-نقاش-مرشح-رئاسي(9-23)-...لماذا-رشحوا-أنفسهم-؟) عدد الزوار 56


بمقارنة عدد الزوار لكل موضوع وبكامل حرية المهتم
نقول أن الاهتمام كان من نصيب
الأول عمر سليمان
والثاني خيرت الشاطر
وهذا يتطابق فعلا مع النتيجة قبل الإستبعاد
وبعد الإستبعاد نجد أن الإهتمام وحسب عدد الزوار يكون بالترتيب

3-سلسلة نقاش مرشح رئاسي(7) عبد المنعم ابو الفتوح (http://www.almolltaqa.com/ib/showthread.php?96671-سلسلة-نقاش-مرشح-رئاسي(7)-عبد-المنعم-ابو-الفتوح) عدد الزوار 294
4-سلسلة نقاش مرشح رئاسي ( 6) حمدين صباحي (http://www.almolltaqa.com/ib/showthread.php?96665-سلسلة-نقاش-مرشح-رئاسي-(-6)-حمدين-صباحي) عدد الزوار 281
5-سلسلة نقاش مرشح رئاسي(8) أحمد شفيق (http://www.almolltaqa.com/ib/showthread.php?96672-سلسلة-نقاش-مرشح-رئاسي(8)-أحمد-شفيق) عدد الزوار 203
7- سلسلة نقاش مرشح رئاسي(5) محمد سليم العوا (http://www.almolltaqa.com/ib/showthread.php?96662-سلسلة-نقاش-مرشح-رئاسي(5)-محمد-سليم-العوا) عدد الزوار 160
8- سلسلة نقاش مرشح رئاسي(3) عمرو موسى (http://www.almolltaqa.com/ib/showthread.php?96550-سلسلة-نقاش-مرشح-رئاسي(3)-عمرو-موسى) عدد الزوار 123
9-سلسلة نقاش مرشح رئاسي(9-23) ...لماذا رشحوا أنفسهم ؟ (http://www.almolltaqa.com/ib/showthread.php?96696-سلسلة-نقاش-مرشح-رئاسي(9-23)-...لماذا-رشحوا-أنفسهم-؟) عدد الزوار 56

فهل يتطابق عدد زوارنا بالنتيجة النهائية لسباق الرئاسة
ننتظر
ونقارن
أما محمد مرسي فلم يكن هدفا لأي حوار لإنه ( الإستبن ) لخيرت الشاطر

اسماعيل الناطور
05-23-2012, 12:58 PM
هنا إحصائية ظريفة من واقع مواضيعي المتعلقة بانتخابات الرئاسية
1-سلسلة نقاش مرشح رئاسي(4) عمر سليمان (http://www.almolltaqa.com/ib/showthread.php?96591-سلسلة-نقاش-مرشح-رئاسي(4)-عمر-سليمان) عدد الزوار 585
2-سلسلة نقاش مرشح رئاسي(2) خيرت الشاطر (http://www.almolltaqa.com/ib/showthread.php?96475-سلسلة-نقاش-مرشح-رئاسي(2)-خيرت-الشاطر) عدد الزوار 433
3-سلسلة نقاش مرشح رئاسي(7) عبد المنعم ابو الفتوح (http://www.almolltaqa.com/ib/showthread.php?96671-سلسلة-نقاش-مرشح-رئاسي(7)-عبد-المنعم-ابو-الفتوح) عدد الزوار 294
4-سلسلة نقاش مرشح رئاسي ( 6) حمدين صباحي (http://www.almolltaqa.com/ib/showthread.php?96665-سلسلة-نقاش-مرشح-رئاسي-(-6)-حمدين-صباحي) عدد الزوار 281
5-سلسلة نقاش مرشح رئاسي(8) أحمد شفيق (http://www.almolltaqa.com/ib/showthread.php?96672-سلسلة-نقاش-مرشح-رئاسي(8)-أحمد-شفيق) عدد الزوار 203
6-سلسلة نقاش مرشح رئاسي(1) صلاح حازم ابو اسماعيل (http://www.almolltaqa.com/ib/showthread.php?96462-سلسلة-نقاش-مرشح-رئاسي(1)-صلاح-حازم-ابو-اسماعيل) عدد الزوار 162
7- سلسلة نقاش مرشح رئاسي(5) محمد سليم العوا (http://www.almolltaqa.com/ib/showthread.php?96662-سلسلة-نقاش-مرشح-رئاسي(5)-محمد-سليم-العوا) عدد الزوار 160
8- سلسلة نقاش مرشح رئاسي(3) عمرو موسى (http://www.almolltaqa.com/ib/showthread.php?96550-سلسلة-نقاش-مرشح-رئاسي(3)-عمرو-موسى) عدد الزوار 123
9-سلسلة نقاش مرشح رئاسي(9-23) ...لماذا رشحوا أنفسهم ؟ (http://www.almolltaqa.com/ib/showthread.php?96696-سلسلة-نقاش-مرشح-رئاسي(9-23)-...لماذا-رشحوا-أنفسهم-؟) عدد الزوار 56


بمقارنة عدد الزوار لكل موضوع وبكامل حرية المهتم
نقول أن الاهتمام كان من نصيب
الأول عمر سليمان
والثاني خيرت الشاطر
وهذا يتطابق فعلا مع النتيجة قبل الإستبعاد
وبعد الإستبعاد نجد أن الإهتمام وحسب عدد الزوار يكون بالترتيب

3-سلسلة نقاش مرشح رئاسي(7) عبد المنعم ابو الفتوح (http://www.almolltaqa.com/ib/showthread.php?96671-سلسلة-نقاش-مرشح-رئاسي(7)-عبد-المنعم-ابو-الفتوح) عدد الزوار 294
4-سلسلة نقاش مرشح رئاسي ( 6) حمدين صباحي (http://www.almolltaqa.com/ib/showthread.php?96665-سلسلة-نقاش-مرشح-رئاسي-(-6)-حمدين-صباحي) عدد الزوار 281
5-سلسلة نقاش مرشح رئاسي(8) أحمد شفيق (http://www.almolltaqa.com/ib/showthread.php?96672-سلسلة-نقاش-مرشح-رئاسي(8)-أحمد-شفيق) عدد الزوار 203
7- سلسلة نقاش مرشح رئاسي(5) محمد سليم العوا (http://www.almolltaqa.com/ib/showthread.php?96662-سلسلة-نقاش-مرشح-رئاسي(5)-محمد-سليم-العوا) عدد الزوار 160
8- سلسلة نقاش مرشح رئاسي(3) عمرو موسى (http://www.almolltaqa.com/ib/showthread.php?96550-سلسلة-نقاش-مرشح-رئاسي(3)-عمرو-موسى) عدد الزوار 123
9-سلسلة نقاش مرشح رئاسي(9-23) ...لماذا رشحوا أنفسهم ؟ (http://www.almolltaqa.com/ib/showthread.php?96696-سلسلة-نقاش-مرشح-رئاسي(9-23)-...لماذا-رشحوا-أنفسهم-؟) عدد الزوار 56

فهل يتطابق عدد زوارنا بالنتيجة النهائية لسباق الرئاسة
ننتظر
ونقارن
أما محمد مرسي فلم يكن هدفا لأي حوار لإنه ( الإستبن ) لخيرت الشاطر
رشحت بفضل الله تعالى محمد سليم العوا لأني وجدته الأفضل على ضوء المعايير التي وضعتها في موضوعي ( الوصايا العشر لاختيار رئيس مصر ) بالملتقى الاسلامي على هذا الرابط http://www.almolltaqa.com ، وخاصة بعد أن اطلعت على الـ ( cv ) الخاص به بالموضوع الماثل ، فشكرا للأستاذ الناطور على مساعدتي في هذا الإختيار .
وشكرا لك وشكرا لكل إنسان يبحث عن المعلومة الصادقة والتي ترفعه في الآخرة عند الله ...
محمد سليم العوا فيه الخير إن شاء قبل الترشيح وإن نجح فيما نذكره من أجله أم لا فهو قيمة مصرية عربية اسلامية علما وأخلاق

اسماعيل الناطور
05-23-2012, 02:25 PM
الحقيقة محمد مرسي كالحجر الذي قذفه مجنون في فرح , فلقد أصاب حساباتنا وحسابات الآخرين بالإرتباك , فلا هو سينجح ولا هو ترك الآخرين ينجحون
وسيبقى سر دخول الشاطر وإجبار عمر سليمان على الدخول , وسر خروجها وترك الملعب لفوضى محمد مرسي , سيقبى السر الذي لابد أن نعرفه يوما
من خطط ؟, ولماذا ؟, ولمصلحة من ؟......
محمد مرسي نشاز الحملة الرئاسية ...
فمن خدع الأخوان أو من أوقع الأخوان في هذه المتاهه والتي هي ضد رغبتهم في الإستيلاء على كل شيئ
ولكن من الغباء ما قتل !!!
الواضح من أدخل مرسي أراد النجاح لأبو الفتوح بتوجيه أصوات السلف والأخوان له
ومن الواضح من ساند حمدين أراد أيضا النجاح لأبو الفتوح بسرقة أصوات الطرف الآخر من أحمد شفيق
لذلك بالتأكيد سينجح أبو الفتوح بنسبة تفوق 25% وسيضمن الصعود للدور النهائي حيث المعركة الحقيقية للرئاسة
ولكن من هو الثاني ؟
ومن هو الثالث ؟
ومن هو الرابع ؟
ومن هو الخامس ؟
وأين موقع محمد مرسي بينهما

[/URL] http://www.almolltaqa.com/vb/images/statusicon/post_new.gif [URL="http://www.almolltaqa.com/ib/showthread.php?32550-ملف-الإنتخابات-في-بلاد-العرب"]ملف الإنتخابات في بلاد العرب (http://www.almolltaqa.com/ib/showthread.php?32550-ملف-الإنتخابات-في-بلاد-العرب&goto=newpost)

1 (http://www.almolltaqa.com/ib/showthread.php?32550-ملف-الإنتخابات-في-بلاد-العرب) 2 (http://www.almolltaqa.com/ib/showthread.php?32550-ملف-الإنتخابات-في-بلاد-العرب/page2) 3 (http://www.almolltaqa.com/ib/showthread.php?32550-ملف-الإنتخابات-في-بلاد-العرب/page3) 4 (http://www.almolltaqa.com/ib/showthread.php?32550-ملف-الإنتخابات-في-بلاد-العرب/page4) 5 (http://www.almolltaqa.com/ib/showthread.php?32550-ملف-الإنتخابات-في-بلاد-العرب/page5) ... 34 (http://www.almolltaqa.com/ib/showthread.php?32550-ملف-الإنتخابات-في-بلاد-العرب/page34)

اسماعيل الناطور
05-23-2012, 03:42 PM
1- المتواجدون أمام لجنة الأنتخابات الرئاسية يتصدون لنجلاء فتحى أثناء قيامها بالدعاية لمرشحها حمدين صباحى أمام لجنة الإنتخابات
2-بجاتو»: إحالة «سيدة» و7 من أنصار «شفيق وموسى ومرسي وأبو الفتوح» للنيابة | المصري اليوم، أخبار اليوم
ألقت قوات الأمن القبض على عدد من أنصار المرشحين لرئاسة الجمهورية، أحدهم سيدة في لجنة الزاوية الحمراء حاولت التصويت ببطاقة سيدة أخرى، حسبما تلقت غرف عمليات اللجنة العليا لانتخابات الرئاسة...
3-«العليا للرئاسة» تُحيل شكوى ضد شفيق للنيابة لإقامته مؤتمرًا في «الصمت الانتخابي»
4-عضو مجلس الشعب عن حزب الحرية والعدالة عن دائرة مركزي طامية بالفيوم، يقوم بتوجيه الناخبين لصالح محمد مرسي مرشح الحزب.
5-الاخوان امام لجنة أبوالهول يوقفون المارة لحثهم على انتخاب محمد مرسى ..
6- الفنانة ندى بسيوني تعطي صوتها لـ''شفيق'' دعماً للاستقرار
7-عاجل وهام :
الساده الاقباط في مصر توحدو اليوم علي الفريق احمد شفيق وهم يصوتون 11 مليون صوت وايضا نقابة الاشراف والهواره بالصعيد والقبائل العربيه بمطروح واولاد علي وهم يصوتون اكثر
من 3 مليون وايضا الساده مشايخ الطرق الصوفيه وعددهم الرسمي حسب النقابه 9 مليون صوت يؤيدون الفريق لآن والده احد مشايخ الطرق الصوفيه والفلول يصوتون بما لا يقل عن 8 مليون صوت وايضا توحدو علي الفريق واهالي ضباط وافراد الشرطه وهم حوالي 1 مليون واهالي القوات المسلحه والمتقاعدين حوالي 1 مليون وايضا ,7 مليون بالسياحه والدكتور مجدي يعقوب وفاروق الباز والشيخ احمد عمر هاشم
8-ألقت الأجهزة والخدمات الأمنية بالقاهرة القبض على عامل بدار السلام من أنصار حمدين صباحى، ويحمل منشورات مضادة للمرشحين عمرو موسى وأحمد شفيق
9-وفر حزب الحرية والعدالة فى منطقة شرق شبرا الخيمة، عربات لنقل الناخبين من منازلهم إلى لجان الاقتراع مباشرة،
10- كثر التجاوزات حتى الآن من حملة محمد مرسي مرشح الإخوان المسلمين , فقد تم ضبط أكثر من حالة تجاوز ومخالفه للقوانين خاصه بحملته في أكثر من مقر انتخابي على مستوى الجمهورية , وصلت إلى غلق بعض اللجان , وتم اتخاذ الإجراءات القانونيه اللازمه ضدهم !!!
إلى الإخوان المتأسلمين: مهما حاولتم أنتم أو غيركم , ستتم العمليه الانتخابيه على خير بإذن الله , وسيعبر الشعب المصري عن رأيه بكل حريه وشفافيه في حماية من قواته المسلحه , التي ستحمى إرادته من أي متمرد يدبر لكي يحرق الوطن إذا خرجت الرئاسة عن مرشحه , فستجدون هؤلاء الجنود .. جنود مصر .. جنود الشعب , يقفون لكم أو لغيركم بالمرصاد , راضين عن اختيار الشعب ومحترمين لإرادته , قامعين لكل محاولات التمرد أو إشاعة الفوضى في أرجاء الوطن !!
11-أنصار موسى وأبو الفتوح يتراشقان بالحجارة فى لجنة بالحوامدية
....وتستمر أخبار الفيس بوك

اسماعيل الناطور
05-23-2012, 09:32 PM
هنا إحصائية ظريفة من واقع مواضيعي المتعلقة بانتخابات الرئاسية
1-سلسلة نقاش مرشح رئاسي(4) عمر سليمان (http://www.almolltaqa.com/ib/showthread.php?96591-سلسلة-نقاش-مرشح-رئاسي(4)-عمر-سليمان) عدد الزوار 585
2-سلسلة نقاش مرشح رئاسي(2) خيرت الشاطر (http://www.almolltaqa.com/ib/showthread.php?96475-سلسلة-نقاش-مرشح-رئاسي(2)-خيرت-الشاطر) عدد الزوار 433
3-سلسلة نقاش مرشح رئاسي(7) عبد المنعم ابو الفتوح (http://www.almolltaqa.com/ib/showthread.php?96671-سلسلة-نقاش-مرشح-رئاسي(7)-عبد-المنعم-ابو-الفتوح) عدد الزوار 294
4-سلسلة نقاش مرشح رئاسي ( 6) حمدين صباحي (http://www.almolltaqa.com/ib/showthread.php?96665-سلسلة-نقاش-مرشح-رئاسي-(-6)-حمدين-صباحي) عدد الزوار 281
5-سلسلة نقاش مرشح رئاسي(8) أحمد شفيق (http://www.almolltaqa.com/ib/showthread.php?96672-سلسلة-نقاش-مرشح-رئاسي(8)-أحمد-شفيق) عدد الزوار 203
6-سلسلة نقاش مرشح رئاسي(1) صلاح حازم ابو اسماعيل (http://www.almolltaqa.com/ib/showthread.php?96462-سلسلة-نقاش-مرشح-رئاسي(1)-صلاح-حازم-ابو-اسماعيل) عدد الزوار 162
7- سلسلة نقاش مرشح رئاسي(5) محمد سليم العوا (http://www.almolltaqa.com/ib/showthread.php?96662-سلسلة-نقاش-مرشح-رئاسي(5)-محمد-سليم-العوا) عدد الزوار 160
8- سلسلة نقاش مرشح رئاسي(3) عمرو موسى (http://www.almolltaqa.com/ib/showthread.php?96550-سلسلة-نقاش-مرشح-رئاسي(3)-عمرو-موسى) عدد الزوار 123
9-سلسلة نقاش مرشح رئاسي(9-23) ...لماذا رشحوا أنفسهم ؟ (http://www.almolltaqa.com/ib/showthread.php?96696-سلسلة-نقاش-مرشح-رئاسي(9-23)-...لماذا-رشحوا-أنفسهم-؟) عدد الزوار 56


بمقارنة عدد الزوار لكل موضوع وبكامل حرية المهتم
نقول أن الاهتمام كان من نصيب
الأول عمر سليمان
والثاني خيرت الشاطر
وهذا يتطابق فعلا مع النتيجة قبل الإستبعاد
وبعد الإستبعاد نجد أن الإهتمام وحسب عدد الزوار يكون بالترتيب

3-سلسلة نقاش مرشح رئاسي(7) عبد المنعم ابو الفتوح (http://www.almolltaqa.com/ib/showthread.php?96671-سلسلة-نقاش-مرشح-رئاسي(7)-عبد-المنعم-ابو-الفتوح) عدد الزوار 294
4-سلسلة نقاش مرشح رئاسي ( 6) حمدين صباحي (http://www.almolltaqa.com/ib/showthread.php?96665-سلسلة-نقاش-مرشح-رئاسي-(-6)-حمدين-صباحي) عدد الزوار 281
5-سلسلة نقاش مرشح رئاسي(8) أحمد شفيق (http://www.almolltaqa.com/ib/showthread.php?96672-سلسلة-نقاش-مرشح-رئاسي(8)-أحمد-شفيق) عدد الزوار 203
7- سلسلة نقاش مرشح رئاسي(5) محمد سليم العوا (http://www.almolltaqa.com/ib/showthread.php?96662-سلسلة-نقاش-مرشح-رئاسي(5)-محمد-سليم-العوا) عدد الزوار 160
8- سلسلة نقاش مرشح رئاسي(3) عمرو موسى (http://www.almolltaqa.com/ib/showthread.php?96550-سلسلة-نقاش-مرشح-رئاسي(3)-عمرو-موسى) عدد الزوار 123
9-سلسلة نقاش مرشح رئاسي(9-23) ...لماذا رشحوا أنفسهم ؟ (http://www.almolltaqa.com/ib/showthread.php?96696-سلسلة-نقاش-مرشح-رئاسي(9-23)-...لماذا-رشحوا-أنفسهم-؟) عدد الزوار 56

فهل يتطابق عدد زوارنا بالنتيجة النهائية لسباق الرئاسة
ننتظر
ونقارن
أما محمد مرسي فلم يكن هدفا لأي حوار لإنه ( الإستبن ) لخيرت الشاطر

ماذا يعني نجاح عبد المنعم أبو الفتوح

وتفوقه على مرشح جماعة الإخوان المسلمين
بالنسبة لك وبالنسبة لجماعة الإخوان المسلمين ولكل
القوى الوطنية الأخرى ؟
وهل حقا كما قال أحد الإخوان .. نار شفيق ولا جنة أبو الفتوح ؟
على اعتبار أن نجاح شفيق يمكن تفسيره وتبريره أمام الناس
بينما لايمكن تفسير ولا تبرير نجاح أبو الفتوح
الذي يحمل نفس الأفكار والرؤى ؟
أتمنى من الجميع التفاعل وإبداء الرأي .


وهل حقا كما قال أحد الإخوان .. نار شفيق ولا جنة أبو الفتوح ؟

أحد الإحتمالات التي لا يجب أن يستبعدها المراقب لقوى المرشحين والنتائج المحتملة , هناك إحتمال صعود محمد مرسي وابو الفتوح للدور النهائي ( انا شخصيا أستبعد ذلك ) ,
في هذه الحالة
لن يكون من الأطراف إلا مواجهة الحقيقة حقيقة البحث عن السلطة وليس البحث عن النهضة , فلا فلول , ولا تحرريين , ولا مزايدات دينية وحملات إعلامية تشتت عقول الجماهير , وأعتقد أن هذه الحالة بالذات (إن حدثت ) ستكون بداية التفجير والذي لا يستبعد إنقلابا عسكريا مؤيدا وموافقا عليه من كل قوى الشعب , حتى من بين الإخوان أنفسهم , ولكن بعد أن يمزقوا الإخوان ثياب بعضهم وربما ثياب مصر ....إلا إذا تنازل أحدهم لأحدهم تحت ظل حكم المرشد , الله يحميك يا مصر

اسماعيل الناطور
05-24-2012, 12:38 AM
هنا إحصائية ظريفة من واقع مواضيعي المتعلقة بانتخابات الرئاسية
1-سلسلة نقاش مرشح رئاسي(4) عمر سليمان (http://www.almolltaqa.com/ib/showthread.php?96591-سلسلة-نقاش-مرشح-رئاسي(4)-عمر-سليمان) عدد الزوار 585
2-سلسلة نقاش مرشح رئاسي(2) خيرت الشاطر (http://www.almolltaqa.com/ib/showthread.php?96475-سلسلة-نقاش-مرشح-رئاسي(2)-خيرت-الشاطر) عدد الزوار 433
3-سلسلة نقاش مرشح رئاسي(7) عبد المنعم ابو الفتوح (http://www.almolltaqa.com/ib/showthread.php?96671-سلسلة-نقاش-مرشح-رئاسي(7)-عبد-المنعم-ابو-الفتوح) عدد الزوار 294
4-سلسلة نقاش مرشح رئاسي ( 6) حمدين صباحي (http://www.almolltaqa.com/ib/showthread.php?96665-سلسلة-نقاش-مرشح-رئاسي-(-6)-حمدين-صباحي) عدد الزوار 281
5-سلسلة نقاش مرشح رئاسي(8) أحمد شفيق (http://www.almolltaqa.com/ib/showthread.php?96672-سلسلة-نقاش-مرشح-رئاسي(8)-أحمد-شفيق) عدد الزوار 203
6-سلسلة نقاش مرشح رئاسي(1) صلاح حازم ابو اسماعيل (http://www.almolltaqa.com/ib/showthread.php?96462-سلسلة-نقاش-مرشح-رئاسي(1)-صلاح-حازم-ابو-اسماعيل) عدد الزوار 162
7- سلسلة نقاش مرشح رئاسي(5) محمد سليم العوا (http://www.almolltaqa.com/ib/showthread.php?96662-سلسلة-نقاش-مرشح-رئاسي(5)-محمد-سليم-العوا) عدد الزوار 160
8- سلسلة نقاش مرشح رئاسي(3) عمرو موسى (http://www.almolltaqa.com/ib/showthread.php?96550-سلسلة-نقاش-مرشح-رئاسي(3)-عمرو-موسى) عدد الزوار 123
9-سلسلة نقاش مرشح رئاسي(9-23) ...لماذا رشحوا أنفسهم ؟ (http://www.almolltaqa.com/ib/showthread.php?96696-سلسلة-نقاش-مرشح-رئاسي(9-23)-...لماذا-رشحوا-أنفسهم-؟) عدد الزوار 56


بمقارنة عدد الزوار لكل موضوع وبكامل حرية المهتم
نقول أن الاهتمام كان من نصيب
الأول عمر سليمان
والثاني خيرت الشاطر
وهذا يتطابق فعلا مع النتيجة قبل الإستبعاد
وبعد الإستبعاد نجد أن الإهتمام وحسب عدد الزوار يكون بالترتيب

3-سلسلة نقاش مرشح رئاسي(7) عبد المنعم ابو الفتوح (http://www.almolltaqa.com/ib/showthread.php?96671-سلسلة-نقاش-مرشح-رئاسي(7)-عبد-المنعم-ابو-الفتوح) عدد الزوار 294
4-سلسلة نقاش مرشح رئاسي ( 6) حمدين صباحي (http://www.almolltaqa.com/ib/showthread.php?96665-سلسلة-نقاش-مرشح-رئاسي-(-6)-حمدين-صباحي) عدد الزوار 281
5-سلسلة نقاش مرشح رئاسي(8) أحمد شفيق (http://www.almolltaqa.com/ib/showthread.php?96672-سلسلة-نقاش-مرشح-رئاسي(8)-أحمد-شفيق) عدد الزوار 203
7- سلسلة نقاش مرشح رئاسي(5) محمد سليم العوا (http://www.almolltaqa.com/ib/showthread.php?96662-سلسلة-نقاش-مرشح-رئاسي(5)-محمد-سليم-العوا) عدد الزوار 160
8- سلسلة نقاش مرشح رئاسي(3) عمرو موسى (http://www.almolltaqa.com/ib/showthread.php?96550-سلسلة-نقاش-مرشح-رئاسي(3)-عمرو-موسى) عدد الزوار 123
9-سلسلة نقاش مرشح رئاسي(9-23) ...لماذا رشحوا أنفسهم ؟ (http://www.almolltaqa.com/ib/showthread.php?96696-سلسلة-نقاش-مرشح-رئاسي(9-23)-...لماذا-رشحوا-أنفسهم-؟) عدد الزوار 56

فهل يتطابق عدد زوارنا بالنتيجة النهائية لسباق الرئاسة
ننتظر
ونقارن
أما محمد مرسي فلم يكن هدفا لأي حوار لإنه ( الإستبن ) لخيرت الشاطر
على شريط الإهداء في الملتقى أجد
يسري مصطفى (http://almolltaqa.com/ib/member.php?u=6743) مؤشرات اليوم الاول في انتخابات الرئاسة المصرية / الاول محمد مرسي / الثاني عبدالمنعم ابو الفتوح / الثالث حمدين صباحي / الرابع احمد شفيق / الخامس عمر موسى / مؤشرات وليس وقائع والتكملة غدا تغير الكثير قطعا http://almolltaqa.com/ib/favicon.ico
وهذا يتوافق بنسبة عالية مع توقعاتنا الظريفة بقياس عدد الزوار

أبو صالح
05-24-2012, 04:58 AM
ثورة الحمير بقلم/ اسماعيل الناطور
أرجو الانتباه كيف يتقاسم الأدوار بطريقة مباشرة أو غير مباشرة (وفق مبدأ عدو عدوي صديقي) لتشويه صورة وسمعة انتفاضات أدوات العولمة ما بين كل من محمد شعبان الموجي واسماعيل الناطور ويسري راغب شراب (والمتنكر تحت اسم يسري مصطفى وهو ومازن أبو فاشا (د.فراس عدنان) لهم من الرتب والصلاحيات الإدارية والألوان الحمراء من قبل محمد شعبان الموجي بالاسماء المتنكرة لكي يعلم الجميع مستوى الغش لديه) وهذا يوضح ارتباطهم بالأجهزة الأمنية والإعلامية مثل اعيان القيسي وغازية منصور الغجري لخدمة النظام كأي مثقف من مثقفي دولة الفلسفة
وهل حقا كما قال أحد الإخوان .. نار شفيق ولا جنة أبو الفتوح ؟

أحد الإحتمالات التي لا يجب أن يستبعدها المراقب لقوى المرشحين والنتائج المحتملة , هناك إحتمال صعود محمد مرسي وابو الفتوح للدور النهائي ( انا شخصيا أستبعد ذلك ) ,
في هذه الحالة
لن يكون من الأطراف إلا مواجهة الحقيقة حقيقة البحث عن السلطة وليس البحث عن النهضة , فلا فلول , ولا تحرريين , ولا مزايدات دينية وحملات إعلامية تشتت عقول الجماهير , وأعتقد أن هذه الحالة بالذات (إن حدثت ) ستكون بداية التفجير والذي لا يستبعد إنقلابا عسكريا مؤيدا وموافقا عليه من كل قوى الشعب , حتى من بين الإخوان أنفسهم , ولكن بعد أن يمزقوا الإخوان ثياب بعضهم وربما ثياب مصر ....إلا إذا تنازل أحدهم لأحدهم تحت ظل حكم المرشد , الله يحميك يا مصر
والتناقض مع ما ورد في المداخلة التي تليها ليبين لنا وكأنّه هو يتكلم عن الواقع بينما غيره لا يتكلم إلاّ عن مؤشرات
[/FONT]
على شريط الإهداء في الملتقى أجد
يسري مصطفى (http://almolltaqa.com/ib/member.php?u=6743) مؤشرات اليوم الاول في انتخابات الرئاسة المصرية / الاول محمد مرسي / الثاني عبدالمنعم ابو الفتوح / الثالث حمدين صباحي / الرابع احمد شفيق / الخامس عمر موسى / مؤشرات وليس وقائع والتكملة غدا تغير الكثير قطعا http://almolltaqa.com/ib/favicon.ico
وهذا يتوافق بنسبة عالية مع توقعاتنا الظريفة بقياس عدد الزوار
أي هو يقول لنا بأنّه يعلم الغيب ولا حول ولا قوة إلا بالله
وهو الوحيد الذي له عقل ولا يعترف بغيره، فهو خلاصة العقل
ولذلك هو الذي له الحق في تسفيه واغتيال وقتل كل من يحلو له تماما، بلا منطق ولا موضوعية وبانتقائية ومزاجية كما قام به تحت العنوان والرابط التالي
ابو صالح بقلم/ اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=17337 (http://wata1.com/vb/showthread.php?t=17337)
والمأساة عندما أرد على هجومك وأكاذيبك ليس بنفس اسلوبك الخسيس وإلاّ سأكون مثلك وحاشا لله أن أكون مثل عبيد جمال عبدالناصر ومحمد حسنين هيكل
ولكن بأشياء حقيقية قمت بها أنت وأتحداك أن تُكذّب أي شيء ورد في مداخلاتي أو أن تُشكّك في مصداقيته على الأقل
تقوم بدل تفنيد ما طرحته إلى استغلال الصلاحيات ليس لغلق الموضوع فقط بل بحذف بعض ردودي كذلك
والأنكى من بعد ذلك أنت ترجع لإعادة نشر أكاذيبك وسرقاتك الأدبية من الآخرين فيه
يا اسماعيل الناطور يا أيها السارق ويا أيها الخسيس والجبان ما تفعله ليس فيه شيء سوى تبيان كم أنت خسيس ومجرم تماما كما هو حال ما قمت به بعناوين لمواضيع تبين فيها أن مستوى ذكائهم لا يتعدى مستوى الحيوانات والحشرات وبأسلوب سوقي ومبتذل تجاه أهل انتفاضات أدوات العولمة التي قامت ضد الظلم والاستبداد والاستعباد،
ولكن لأنك أنت عبد لصاحب السلطة وأذنابه من أمثال شفيق ومبارك والسادات فلذلك تحرص على ايراد الأخبار التي تعمل على نفخه ونفخ حملته الانتخابية من الفيسبوك الآن، بالرغم من كل مواقفك السلبية تجاه انتفاضات أدوات العولمة كانت تحت حجة ارتباطهم بالفيسبوك وغووغل وغيره فأي تناقض وأي سفالة وأي حقارة تمثله مثل هذه التصرفات؟!!!
ما رأيكم دام فضلكم؟

اسماعيل الناطور
05-24-2012, 03:00 PM
الدجال المنتظر
هناك قرية .....
عليها فتوة وعساكر .
فتوة كأي فتوة , الفعل لمصلحته , الضرائب لمتعته ,
وقوته آمان القرية وإستقرارها , ومصدر رعبها وخوفها .
قوة الخوف قيدهم , فصبروا على الفقر , وتغنوا بقوة الفتوة , ونشدوا أناشيد الأمان سنين طوال.
وذات يوم ....
ولطول صبرهم , مل الخوف منهم , وترك قريتهم .
, كسروا القيود , الشريف والافاق والكذاب احرارا وبدون قيود ,
رقصوا , تجمعوا , خرجوا على قدم واحدة ,
........ سجنوا الفتوة.........
وفرقهم الكذاب
وحكمهم الدجال

</i>

أبو صالح
05-24-2012, 03:22 PM
في سورة الحجر آية 56 تقول" قَالَ وَمَن يَقْنَطُ مِن رَّحْمَةِ رَبِّهِ إِلاَّ الضَّآلُّونَ "
وهل هناك مثقف دولة فلسفة غير قانط؟ أي جندي في الطابور الخامس ويكفي ما ورد في هذا الموضوع أكبر دليل على ذلك

اسماعيل الناطور
05-24-2012, 03:28 PM
الأستاذ القدير المفكر إسماعيل الناطور ..
أيها العربي الأصيل .. الكذاب و الدجال من علامات يوم القيامة .. المسلم لا يكذب هكذا قالها رسولنا الأعظم صلوات الله عليه من خلال حديثه الشريف المعروف صدق رسول الله ..
أما فتنة الدجال و العياذ بالله منه فمن يستطيع إنكارها و هي المؤكدة في ديننا الحنيف .. منذ فترة شاهدت حدثيا للشيخ عرفة الجليل شيخ أقصانا الحبيب يحذر بها من فتنة الدجال و أوصانا بأن نردد بإستمرار ( سبحان الله و بحمده )
دائما تصيب في رؤياك البعيدة قلب الحدث و ما قد ينتج عنه ..
سلمت أيها المفكر القدير .. و يشرفني بأن مررت بكلماتي المتواضعة هذه التي لا تفي نصك حقه
إحترامي .. تحياتي

الحمد لله ...
وما فائدة البصر إن لم يترافق مع البصيرة
البصر أداة.... قد يخدعها مخادع إن لم تقم البصيرة بحمايتها من الدجال

أبو صالح
05-24-2012, 03:54 PM
ثورة الحمير بقلم/ اسماعيل الناطور
الحمد لله ...
وما فائدة البصر إن لم يترافق مع البصيرة
البصر أداة.... قد يخدعها مخادع إن لم تقم البصيرة بحمايتها من الدجال
المسلم لا يكذب، ولكن المثقف يؤمن بأنّ الكذب ملح الرجال؟!
فكيف بمن يقول عن الأبيض أسود ومن ثم يصدر فتواه على اللون الأسود؟
فعن أي بصر وأي بصيرة خصوصا وهو لا يلتزم حتى باسماء الألوان؟
اسأل الله أن يخزيكم يا اسماعيل الناطور على هذا التزييف المتعمد للوعي لتشويه انتفاضات أدوات العولمة من قبلك أو من قبل عبدالرحيم محمود كما هو حاصل في الروابط التالية
http://almolltaqa.com/ib/showthread.php?97395-ثورات-أم-مهازل-عبد-الرحيم-محمود (http://almolltaqa.com/ib/showthread.php?97395-ثورات-أم-مهازل-عبد-الرحيم-محمود)
أو من قبل محمد شعبان الموجي كما هو حاصل في الروابط التالية
http://almolltaqa.com/ib/showthread.php?97470-هل-يرى-الإخوان-أن-نار-شفيق-ولا-جنة-أبو-الفتوح-؟؟؟؟ (http://almolltaqa.com/ib/showthread.php?97470-هل-يرى-الإخوان-أن-نار-شفيق-ولا-جنة-أبو-الفتوح-؟؟؟؟)
ما هذا الغباء هل سأله أحد أين ومن هو الذي صرّح هذه التصريحات قبل أن يتم مناقشتها أصلا

اسماعيل الناطور
05-24-2012, 06:34 PM
الدجال المنتظر

هناك قرية .....
عليها فتوة وعساكر .
فتوة كأي فتوة , الفعل لمصلحته , الضرائب لمتعته ,
وقوته آمان القرية وإستقرارها , ومصدر رعبها وخوفها .
قوة الخوف قيدهم , فصبروا على الفقر , وتغنوا بقوة الفتوة , ونشدوا أناشيد الأمان سنين طوال.
وذات يوم ....
ولطول صبرهم , مل الخوف منهم , وترك قريتهم .
, كسروا القيود , الشريف والافاق والكذاب احرارا وبدون قيود ,
رقصوا , تجمعوا , خرجوا على قدم واحدة ,
........ سجنوا الفتوة.........
وفرقهم الكذاب
وحكمهم الدجال



أمثال قريتك يا سيدى كثر

ويا ويلنا من جميعهم
سجنوا الفتوة.........
وفرقهم الكذاب
وحكمهم الدجال
أم أننا نستحقهم بضعفنا؟
أراك بطرف خفى تشير إلى قرية أعرفها، فالإسقاط واضح جلى
خوفتنا من القادم يا رجل
نسأل الله السلامة
شكرى وتقديرى لكم

لا هنتم وكونوا بخير

نسأل الله السلامة
لأن الدجال له قدرات خاصة , وإلا ما أطلقنا عليه دجال
إلا بعد أن نكتوي بنار الخديعة

اسماعيل الناطور
05-24-2012, 09:27 PM
العنوان هو " الدجال المنتظر "
وكأن أخي الناطور يسبق الأحداث ويقرر أن
الآتي دجالا كائنا من يكون .
أم أن في ذهنه دجالا معينا ويتوقع فوزه باليقين الذي يشاهده ونشاهده معهه على الأرض ؟
تحياتي
فوزي بيترو
الدجال قادم , فنحن أحفاد قابيل , الذي قتل أخاه من أجل إمرأة
فهل نجا موسى وعيسى عليهما السلام من الدجال حتى نطلب نجاة أنفسنا
ما هي إلا أيام , والدجال يعود , فلقد صفق القوم يوما لمن صلب المسيح

اسماعيل الناطور
05-25-2012, 12:50 AM
احييك اخي اسماعيل
وللاسف اصبحت قريتك اليوم مثالا
امتد مع الريح الى ابعد ما كنا نتصور
قفلة جميله وموحيه
ابدعت
نعم هي ريح متوقعة وإن كانت في غفلة من نيام
وريحها أحمر بلون الدم , والدجال قادم
ليقول لهم أن هذا الدم هو قربان الولاء لي

اسماعيل الناطور
05-25-2012, 10:56 AM
نعم هي ريح متوقعة وإن كانت في غفلة من نيام

وريحها أحمر بلون الدم , والدجال قادم
ليقول لهم أن هذا الدم هو قربان الولاء لي


الإستبن يحصل على أعلى الأصوات
زوجة الدكتور مرسي تنفي الرشاوي والسكر والزيت ولا تعطي تفسيرا لتقدم رجل نزل بالباراشوت على عين الناخب المصرية
http://www.almasryalyoum.com//sites/default/files/imagecache/highslide_zoom/photo/2012/05/25/80356/zwj_mrsy.jpg

اسماعيل الناطور
05-25-2012, 11:00 AM
ال مسؤول بجماعة الإخوان المسلمين، الجمعة، لوكالة رويترز،
إن محمد مرسي، مرشح حزب الحرية والعدالة، في أول انتخابات رئاسية في مصر «سيخوض جولة الإعادة الشهر المقبل أمام أحمد شفيق، ».

وأضاف المسؤول، الذي لم تكشف رويترز عن اسمه، أنه «من الواضح أن جولة الإعادة ستكون بين محمد مرسي وأحمد شفيق».

وذكر أن مكتب الإرشاد «سيجتمع لوضع الاستراتيجية لجولة الإعادة المقررة يومي 16 و17 يونيو المقبل».

ومن غير المنتظر إعلان النتائج الرسمية للانتخابات قبل منتصف الأسبوع المقبل، لكن يُسمح لمندوبي المرشحين بحضور الفرز وهو ما يمكنهم من إعداد حصر خاص بهم.

وقال مسؤول الإخوان إن الأصوات التي تم حصرها هي من نحو 12800 لجنة انتخابية من بين 13100 لجنة، وإن «مرسي حصل على 25% من جملة الأصوات مقابل 23% لشفيق و20% لعبد المنعم أبو الفتوح و19% لحمدين صباحي».

اسماعيل الناطور
05-25-2012, 11:08 AM
عاجل ومؤكد بعد فرز 83% من اللجان الفرعية: «مرسي» و«شفيق» في جولة الإعادة
الجمعة 25 مايو 2012 - 9:51 ص ا بتوقيت القاهرة
خاص الشروق
كتب- محمد بصل:
أكدت مصادر قضائية رفيعة المستوى، أن: "المؤشرات شبه النهائية لنتائج اللجان الفرعية على مستوى الجمهورية، تشير إلى إجراء جولة إعادة في الانتخابات الرئاسية بين مرشح الإخوان محمد مرسي ورئيس الوزراء الأسبق أحمد شفيق، وخروج المرشحين الثلاثة حمدين صباحي وعبد المنعم أبو الفتوح وعمرو موسى خاليي الوفاض".

وأوضحت المصادر أنه: "وبعد فرز أصوات 83% من لجان الجمهورية،
تبين تقدم مرسي بأكثر من 5 ملايين صوت، وتحديدًا 5 ملايين و11 ألفًا و671 صوتًا، مما يعني ضمانه خوض الإعادة".
وفي المركز الثاني أحمد شفيق بأكثر من 4 ملايين صوت، وتحديدًا 4 ملايين و389 ألفًا و289 صوتًا، ما يعني اقترابه جدًا من خوض الإعادة".
وفي المركز الثالث حمدين صباحي، برصيد 3 ملايين و389 ألفًا و234 صوتًا،
وفي المركز الرابع عبد المنعم أبو الفتوح برصيد 3 ملايين و132 ألفًا و576 صوتًا.
وفي المركز الخامس عمرو موسى برصيد مليونين و134 ألفًا و256 صوتًا،
وفي المركزين السادس والسابع محمد سليم العوا وخالد علي، والاثنان لم يكسرا حاجز المائة ألف صوت.

اسماعيل الناطور
05-25-2012, 11:13 AM
أمثال قريتك يا سيدى كثر



ويا ويلنا من جميعهم
سجنوا الفتوة.........
وفرقهم الكذاب
وحكمهم الدجال
أم أننا نستحقهم بضعفنا؟
أراك بطرف خفى تشير إلى قرية أعرفها، فالإسقاط واضح جلى
خوفتنا من القادم يا رجل
نسأل الله السلامة
شكرى وتقديرى لكم

لا هنتم وكونوا بخير

نسأل الله السلامة

لأن الدجال له قدرات خاصة , وإلا ما أطلقنا عليه دجال
إلا بعد أن نكتوي بنار الخديعة

اسماعيل الناطور
05-25-2012, 01:51 PM
الاديب الاستاذ اسماعيل من يحكمنا اليوم يحكمنا بالدجل السياسي
حتى في فضاء الثورات العربية صرنا مدجَلين
لخصت تاريخ عروبتنا المتهالك
تحياتي لقلمك النازف حباً واصالة
حرف على حرف
وكلمة على كلمة
وقلم على قلم
الصدق والجرأة في الحق
سيعود الوعي
وسنقتل الدجال

اسماعيل الناطور
05-25-2012, 10:13 PM
http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash3/553427_366694200060681_271921196204649_1073126_347 710969_n.jpg
ما هو سر تقدم أحمد شفيق وبدون سكر ولا زيت ؟
هل هناك من إجابة

اسماعيل الناطور
05-25-2012, 10:34 PM
العنوان هو " الدجال المنتظر "
وكأن أخي الناطور يسبق الأحداث ويقرر أن
الآتي دجالا كائنا من يكون .
أم أن في ذهنه دجالا معينا ويتوقع فوزه باليقين الذي يشاهده ونشاهده معهه على الأرض ؟
تحياتي
فوزي بيترو
أم أن في ذهنه دجالا معينا

اسماعيل الناطور
05-26-2012, 08:39 AM
الموضوع مفتوح فأين الإشكال ؟






و بلا بطاطين و لكن بالبرانيط (جمع برنيطة و هي قبعة العسكر) !!!


صباح الخير أخي حسين
يبدو أن نسخة الملتقى الجديدة لها من ربيعنا العربي نصيب إذ إنها تقفل وتفتح المواضيع دون إبداء الأسباب , فلقد كان مقفولا قبل نومي , وهذا يحدث كثيرا في الملتقى الخاص ....وأعود لأتاكد من سلامة أقفالها بعد كل مشاركة

اما السكر والزيت والبرانيط فهي عوامل ضعيفة للنجاح لو نظرنا لعدد الأصوات لكل منهما...فمحمد مرسي الإخوان ستة ملايين صوت ...وأحمد شفيق الحكومة والشعب الذي إشتاق للإستقرار ستة ملايين صوت إنتخابي ....
هناك نظرة واقعية وصحيحة لما حدث وكانت متوقعة بين خيرت الشاطر وعمر سليمان ولكن بعد إستبعادهما لم أكن أتوقع أن إلتزام الإخواني نحو جماعته هو أقوى من رأيه الشخصي لذلك لم يحدث فرق بين خيرت الشاطر ومحمد مرسي .....لكن الفرق كان في الطرف المقابل ...فلقد توزعت أصوات عمر سليمان على شفيق وحمدين وعمرو موسى , القادم في مصر سيكون سهلا لمن يفكر وسيكون صعبا لمن لا يفهم أن طريق الإخوان طريق مسدود ولن يؤدي بمصر إلا بمزيدا من الفوضى والضعف الدولي والوطني , كنت أتمنى أن يتقدم محمد سليم العوا , ولكن أحمد شفيق هو فعلا أحسن المتقدمين ولكن ليس أحسن رئيس لمصر , وفي المشاركات القادمة ...سنكتب الكثير

اسماعيل الناطور
05-26-2012, 09:05 AM
بالنظر إلى تسارع الترويج لفكرة تقسم مصر بين "ثورة" و "فلول"

على الأغلب فإن فرصة حماية مصر من تقسيمها هي أن يفتح المجلس العسكري الباب نحو السماح بالتنافس على جولة الإعادة للثلاثة الأوائل معا

من وضع الديمقراطية هدفا وخرج لينادي بها في الشوارع قبل أن يصعد بوعي الجمهور إلى أهمية وقداسة وأمانة الصوت الإنتخابي , فعليه أن يتحمل النتائج
أنا لا ألوم أحدا بقدر ما ألوم من يحمل شعار الاسلام ويحتكم في نفس الوقت لغير قوانينه .
لماذا نلجأ دائما لحفر الحفر تم نبحث عن طريق لردمها بعد الوقوع فيها ؟!!!
أرادوا إنتخابات لشعب سلم إهتماماته يبدأ من رغيف الخبز والأمن , فصوت قسم منهم لرغيف الخبز , والقسم الآخر للأمن .....هذا عدل ومنطقي ودليل أكيد على نزاهة من قادوا الإنتخابات , إذن ليس الحل أن نخرق القانون مرة أخرى ونتقدم بثلاث مرشحين من أجل ردم حفرة التيار الديني هو من إفتعلها حبا في الكرسي , كان عليهم لو كانوا صادقين التوحد مع محمد سليم العوا المتدين المستقل فلا إخوان ولا سلف ولا جهاد ولا ما بينهما , لكنهم أرادوا السلطة , فقهرهم الله ووضعهم في مأزق , وليس عليهم إلا أن يعلنوا وضع أيديهم مع البرادعي ووائل غنيم والحمزاوي وكل من تحرر حتى يصلوا للحكم ولا يضحكوا على الناس بالدين الذي سلبوه الوقار والاحترام إمام الأقوام الأخرى , يمكرون ويمكر الله والله خير الماكرين , خرج علينا البلتاجي ليقول أدعو المجاهد عبد المنعم و الثائر حمدين والمناضل عمرو موسى للتوحد , إنها قمة التلون فهل هذا هو من يحمل شعار الدين , وهل أصبح الناصري كما يدعي حمدين والفلول كما يقولون عن عمرو موسى أخوة نضال , إنهم قوم كراسي ودنيا ....لذلك لا أشاطرك رأي ثلاث مرشحين ...فليطبقوا القانون حتى يكتشف المواطن من يؤيد من ؟ ولماذا؟

اسماعيل الناطور
05-26-2012, 06:22 PM
أحمد ومحمد أسماء أكرم الناس , فرغم أن السادات بعد أن أصبح رئيسا وضع محمد قبل أنور ومبارك وضع محمد قبل حسني إلا أي منهما لم يقتد بمحمد رسول البشرية صلى الله عليه وسلم , وهنا تعود لنا الأسماء بمحمد ولأول مرة ( أحمد ) .....لذلك فلا يزايد أحد على إسلام أحد إلا بالدليل القاطع
ومن يريد أن يفيدنا هنا , عليه أن يفيدنا بالمعلومة أو بالسؤال أو بالحوار الذي يرتقي بالرجال ويرتقي بالقارئ إلى المعرفة , وعليه أن يكون محاورا مجردا من الهوى أو الغرض فكلمة الحق هي العليا , أما الذي يريد أن يستصغر نفسه

محمد إن شاء الله ياسمعة ماتقلقش...




فأقول له ( ياحمادة ) أنت في مكان (رجال ) وموقع إسمه ملتقى المفكرين العرب وليس ملتقى ( العيال ) العرب .
أحمد ومحمد من نشأة دينية , أحمد تربى في بيت الصوفية ومحمد عضوا في تنظيم الإخوان , وعلى من يريد لنفسه رئيسا
أن يسأل نفسه ما هي مواصفات الرئيس التي أريدها ؟ وعليه أن يبحث بالبصر والبصيرة عن أقرب ما فيهما لنفسه
وعليه أن يقرر أن صوته هو قرار وشهادة حق , قد يحاسبه الله عليها إن خان أمانة الناس وأمانة نفسه ووضع نفسه في محل بيع أو شراء

اسماعيل الناطور
05-27-2012, 09:12 AM
وماذا سيحدث فيما إذا ذهب صباحي إلى مرسي وطالبه بسحب ترشيحه تحت طائلة أن أصوات صباحي ستذهب إلى شفيق فيما لو لم يسحب ترشيحه، ومتذرعا بأن من صوت لشفيق قد قام بذلك كراهية للأخوان وليس حبا في شفيق ، وأنه سيسير مع شفيق خاصة وأن نسبة أصواته هي أكبر من أصوات الباقيين جميعا

طبعا لا يملك مرسي أن يهدد بذات الشيء لأنه عندها لن يجد أصواتا حتى ممن صوتوا له

والمهم طبعا أن الجذر اللغوي لكل الأسماء سوف يكون هو ذاته وهو "الحمد" ، فأيضا حمدين مشتق من "الحمد"

تحياتي أخي إسماعيل




وطبعا الحركة التي يقودها هؤلاء السياسيون ستأتي في ظل إعلان صريح من صباحي بأنه لا يملك الأصوات التي انتخبته ولا دخل له في هذه الدعوة ، وستأتي أيضا تصريحات من أبو الفتوح يناشد فيها مرسي عدم التضحية بالثورة مقابل الحكم وسوف يذكره بالوعود التي قطعها الإخوان بعدم دخول السباق الرئاسي ، وسنجد من يشرح مفعول تخويف الشعب من الحكم الديني ويحمل تبعة ذلك للإخوان والأدهى أن موسى سيقف مع مرسي في عدم الإستجابة لهذه الدعوة وسيخرج البعض ليشرح أن قيمة الصوت الثوري هي ثلاثة أرباع الناخبين وأن نسبة التصويت المنخفضة هي السبب وأن المشاركة القادمة ستكون في أعلى نسبها ، وغالبا ستجد جماعة أبريل ينظمون استفتاء لأسر الشهداء على اعتبار أنهم أصحاب الدم الذي ضحى للثورة وأغلبهم بالطبع سيقفون من من يريد غنيم تجييره له

كتبت مشاركتي السابقة قبل أن أقرأ مشاركتك هذه والتي سبقتها ، ولا أتذكر المكان الذي كتبت فيه مشاركة حول أسباب خسارة المرشح الأول والثاني ونجاح الثالث إذا ما حاز على أكثر من خمس الأصوات وخاصة إذا لم يكن محسوبا لا على الإخوان ولا على العسكر

بالمناسبة ما هي النسب الموثوقة أو الأقرب للدقة لأن كل محطة تضع نسبا وترتيبا متضاربا مع الأخرى




طبعا هناك خلاف وطعون , وأقواها مسألة 900 الف صوت يدعي فيها أحدهم أنها تعود لرجال في الداخلية والجيش ....ولكن المعلن الشبه نهائي هو
عبر تجمع "قضاة من أجل مصر - لجنة الانتخابات الموازية" الذي تم تشكيله لمراقبة الانتخابات الرئاسية، ويرأسه المستشار زكريا عبدالعزيز رئيس نادي القضاة السابق، حيث تغطي النتائج 98% من اللجان الانتخابية، بحسب تصريحات المستشار وليد الشرابي، المتحدث الرسمي لحركة "قضاة من أجل مصر" لبوابة الأهرام في ساعة مبكرة من صباح اليوم السبت.
بلغ إجمالي عدد المقيدين 50.524.993،
عدد الحضور 23.025.610 بنسبة مئوية 45.6%،
وجاء عدد الأصوات الصحيحة 22.602.826،
أما عدد الأصوات الباطلة فبلغ 422.784 صوت.
الدكتور محمد مرسي مرشح حزب "الحرية والعدالة" على 5.602.547 صوت بنسبة 24.8%
والفريق أحمد شفيق على 5.404.121 صوت بنسبة 23.9%
وحمدين صباحي على 4.634.506 صوت بنسبة 20.5%
والدكتور عبد المنعم أبو الفتوح على 3.943.931 صوت بنسبة 17.4%
وعمرو موسى على 2.532.267 صوت بنسبة 11.2%.
وإلى يوم الثلاثاء أتذكر موضوعا بعنوان رئيس على وحدة ونصف , فهناك من يتعمد ترقيص المتابع للوصول إلى ما يشبه دوار البحر والرضى بما قسمه له رجال السياسة والمصالح والمخاوف والتي قد تتجاوز الصدق أحيانا , والجذر ( حمد ) قد يحل مشكلة الرئاسة بوصول (حمدين) ولكن لن يحل مشكلة مصر إلا زعيم
وهذه المراحل الانتقالية هي ضياع من عمر الشعوب , لقد وضع الناخب المصري بدفع شفيق نتائج الانتخابات وكل المرشحين في مأزق وخاصة تنظيم الإخوان بقيادة مرسي وتنظيمات الوجه الآخر للثورة وهو متعدد الوجوه ومتعدد الألوان بقيادة النعامة حمدين والديك ابو الفتوح وأسد السرك القومي عمرو موسى , فإما عليهم أن يتحدوا تحت رغبات الشعب ويقنعوا الناخب المصري إنهم ثوار , أم إنهم يسقطعوا في نظر الشعب ويعتبرهم فئة من التجار تلاعبت بمشاعره وفقره وفساد بعض أبناءه ليصلوا للحكم ويعيدوا دورة العبث والمصالح ولعبة الكراسي والتي ظهرت جليا في تصرفات جماعة ابو اسماعيل وجماعة الإخوان , عجبني جدا موقف ابو العلا ماضي رئيس حزب الوسط , ومحمد ابو الغار رئيس حزب مصر الديمقراطي الاجتماعي حينما صرحا معا إننا لا نثق في الإخوان , من السهل عليهم أن يقدموا الوعود ومن الصعب جدا الوفاء بها , لذلك نمنحهم فرصة أسبوع لتقديم قوانين وإتفاقيات مكتوبة ومعلنة أن كل ما نتفق عيه معهم وإلا فنحن لن ننتخب أحدا
فما قامت الثورة ليستولي عليها الإخوان وسنبقى معارضة لهم ولشفيق, هنا أشعر أن هؤلاء رجال مبادئ , ولا يغير موقفه أو تحالفه حسب مصالح أو حيث بيع وشراء , إن الإخوان قد فقدت الثقة في التعامل معها , وهذا ما كنا ننادي به دائما , لا تتكلموا بإسم الاسلام حتى لا تتسببوا في الإساءة له , فعنوان المسلم الوفاء بالعهد , وهذا ما ينقص تنظيم الاخوان والذي أصبح سمة التعاون معهم

اسماعيل الناطور
05-27-2012, 11:15 AM
الدجال المنتظر

هناك قرية .....
عليها فتوة وعساكر .
فتوة كأي فتوة , الفعل لمصلحته , الضرائب لمتعته ,
وقوته آمان القرية وإستقرارها , ومصدر رعبها وخوفها .
قوة الخوف قيدهم , فصبروا على الفقر , وتغنوا بقوة الفتوة , ونشدوا أناشيد الأمان سنين طوال.
وذات يوم ....
ولطول صبرهم , مل الخوف منهم , وترك قريتهم .
, كسروا القيود , الشريف والافاق والكذاب احرارا وبدون قيود ,
رقصوا , تجمعوا , خرجوا على قدم واحدة ,
........ سجنوا الفتوة.........
وفرقهم الكذاب
وحكمهم الدجال


الفتوة والدجال ، وجهان لعملة واحدة اسمها الفساد .
وكما أسقط أهل القرية الفتوة ، فسيسقطون الدجال ولو بعد حين .

المهم أخي عبد العزيز أن ننمي الوعي فينا بالقراءة والملاحظة والمتابعة ودراسة تاريخ كل من يواجهنا حتى لا يضحك علينا الدجال ويطلق على نفسه لقب الصلاح
نعم أسقطنا كثيرا من الدجالين وقد أصبحنا كثرة وغدا ستعم نعمة البصيرة على من تبقى

اسماعيل الناطور
05-27-2012, 01:53 PM
وصف الإعلامي والشاعر عبدالرحمن يوسف إبن يوسف القرضاوي
حصول الفريق أحمد شفيق على 6 ملايين صوت في انتخابات الجولة الأولى بأنه أمر شديد الغرابة، مشيرا إلى أن شفيق لا يمتلك القوة لحشد الأصوات التي حصل عليها.


وقال يوسف، خلال لقائه اليوم، الأحد، في برنامج "صباح دريم":"من المؤكد أن هناك أجهزة أمنية رفيعة المستوى تولت إدارة حملته وتمويلها وتوجيهها".

وأضاف قائلاً: "ما حدث مع الفريق هو ما تم مع عمرو موسى، فمنسقو حملة موسى حصلوا على حقائب الأموال من مرشحهم واختفوا بعدها وأغلقوا هواتفهم المحمولة".

وتابع يوسف: "كيف استطاع شفيق أن يختار ممثليه في القرى والنجوع والكفور؟!! ما حدث ما هو إلا تراكم معلومات لدى أجهزة مخابراتية وتم نقلها إلى شفيق".



يقول المثل الربيعي

حرام على شفيق حلال على مرسي

اسماعيل الناطور
05-27-2012, 02:14 PM
نبدأ بشعار الثورة ....الشعب يريد إسقاط النظام
النظام في مصر الدولة هو مجموعة من القوى
1- مؤسسة الرئاسة
2-وزارة الداخلية
3- مجلس الشعب ومجلس الشورى
4-الجيش
5-القضاء
6-الاعلام
فهل كان يعني الشعار تدمير كل هذه المؤسسات وتسريح قادتها وموظفيها ؟
أم كان يعني الشعار الإبقاء على هذه المؤسسات وإصلاح ما فسد فيها ؟

ونعود إلى شعار الشعب يريد إسقاط النظام ,
وإذا كانت الإجابة (كان يعني الشعار تدمير كل هذه المؤسسات وتسريح قادتها وموظفيها) , فيجب عليه أن يختار محمد مرسي , ن هذا بالضبط ما فعلته حماس عندما نجحت في الإنتخابات وبعدها كان الإنقسام , فتم القضاء على جيش التحرير الفلسطيني وحل مكانه سرايا القسام , رغم إنه الجيش الاكاديمي المتعلم والذي خاض الحروب هو جيش التحرير الفلسطيني من غزة حتى نهر الاردن إلى جنوب لبنان إلى حرب وصمود بيروت بينما سرايا القسام هم شباب مقاوم ومناضل ولكنه أحادي الولاء , وكذلك تم حل جهاز الداخلية والشرطة المتعلمة لصالح جهاز التنفيذية لحماس وهو جهاز أثبت فعاليته فعلا في حفظ الأمن في قطاع غزة , وسقط الرئيس ابو مازن في غزة وهيئة رئاسته لصالح مشعل وهيئة رئاسته , الخلاصة أن بناءا جديدا قام على ارض جرداء تم مسح الماضي عليها وبكل قسوة ولو إنها كانت في غزة مطلوبة في بعض النواحي لأننا وبكل صراحة أرض محتلة وليست دولة , أما مصر فهي دولة حضارات وملكيات وجمهوريات ومسح الماضي تماما وقيام مستقبل على غرار حماس وفتح سيؤدي بالضرورة إلى تقسيم مصر إلى دويلات , كل منها ينشأ مستقبله حسب هواه

اسماعيل الناطور
05-27-2012, 02:15 PM
نتابع سيرنا حول شعار الشعب يريد إسقاط النظام .....
...لو قرأنا كلام ابن يوسف القرضاوي ...نجد إنه يقول أن جهاز المخابرات المصري يدعم شفيق وهو الذي أدى إلى نجاحه , بمعنى إنه وضع الجهاز في موقف عدائي للثورة وبالتالي هو جهاز لمبارك وليس جهاز وطني والمطلوب إستعداء الناس عليه تمهيدا لهدمه , فالمطلوب أقامة كيان جديد على أرض جرداء , وربما البحث عن اسم آخر لأم الدنيا ...ربما جمهورية مصر الإخوانية

اسماعيل الناطور
05-27-2012, 02:34 PM
عاجل
ابو العلا ماضي رئيس حزب الوسط
يطالب بالخطوة الأولى ل جماعة الإخوان.... أن تعتذر للشعب المصري عن أخطاءها بعد الثورة

اسماعيل الناطور
05-27-2012, 02:38 PM
عاجل
نقلت صحيفة "يديعوت أحرونوت" الإسرائيلية عن مصادر سياسية إسرائيلية رفيعة المستوى ترحيبها بتصريحات الرئيس الأمريكى الأسبق جيمى كارتر التى أكد خلالها أن جماعة الإخوان المسلمين ستلتزم بمعاهدة السلام مع إسرائيل الموقعة فى عام 1979، مشيرًا إلى أنهم قد يطلبون إدخال تعديلات على هذه الوثيقة.

إذن ...
ما هو الفرق بين أحمد ومحمد ؟
وأين القدس أولى القبلتين يا محمد ؟

أبو صالح
05-27-2012, 02:43 PM
ثورة الحمير بقلم/اسماعيل الناطور
عاجل
نقلت صحيفة "يديعوت أحرونوت" الإسرائيلية عن مصادر سياسية إسرائيلية رفيعة المستوى ترحيبها بتصريحات الرئيس الأمريكى الأسبق جيمى كارتر التى أكد خلالها أن جماعة الإخوان المسلمين ستلتزم بمعاهدة السلام مع إسرائيل الموقعة فى عام 1979، مشيرًا إلى أنهم قد يطلبون إدخال تعديلات على هذه الوثيقة.

إذن ...
ما هو الفرق بين أحمد ومحمد ؟
وأين القدس أولى القبلتين يا محمد ؟

ما معنى هذه المداخلة يا نصير الفلول يا نصير جمال عبدالناصر ومحمد حسنين هيكل يا اسماعيل الناطور
بوق دعائي لوسائل الإعلام الصهيونية لتصريحات رئيس أمريكي سابق عن عملية هو طبخها تعرف بأسم اتفاقية كامب ديفيد
تهيئة الرأي العام نفسيا لقبول خيانات الفلول والتي بدأ الخيانة فيها جمال عبدالناصر ومحمد حسنين هيكل في تمرير معاهدة روجرز والتي اتفاقية كامب ديفيد وأوسلو لم تخرج عنها حرف يا اسماعيل الناطور يا من يعمل على نفخ برنارد هنري ليفي وعمل منه اسطورة
السؤال هل هناك فرق بين اسلوبك واسلوب اعيان القيسي فيما نشره تحت العنوان والرابط التالي
مجزرة الحوله والاعلام الصهيوني المستعرب بقلم/ اعيان القيسي
http://wata1.com/vb/showthread.php?t=17379 (http://wata1.com/vb/showthread.php?t=17379)
تصرف طبيعي أن يقوم مثقف دولة الفلسفة بالتشكيك، تماما كما قام بها اسماعيل الناطور فور نشر موضوع السجود لصور بشار الأسد، ولكن يا اعيان القيسي وهل أنت تعرف الحقيقة؟ أم ترغب في معرفة الحقيقة؟ أم كل همك هو في كيفية الدفاع عن النظام بأي طريقة كانت وأهم شيء طمس الحقيقة خصوصا عندما تكون ضد مصلحة النظام حسب ما تراها أنت؟ لتوضح مقدار المزاجيّة الانتقائيّة عند المثقف.
الحقيقة هي التي تمثل الشعب وليس النظام أو مصلحته لا من قريب ولا من بعيد يا اعيان القيسي
شتان ما بين صدام حسين أو مُلّا عمر الذين رفضا أن يرضخا لبوش وشعاره من ليس معنا فهو ضدنا في عام 2001 وما بين بشار الأسد أو علي عبدالله صالح أو معمر القذافي أو حسني مبارك أو زين العابدين بن علي أو جمال عبدالناصر أو محمد حسنين هيكل،
كفى متاجرة بدماء الناس، كفى هتك الأعراض، كفى سلب الأموال، كفى استعباد الناس، كفى تشويه كل شيء ناجح ومضيء ومفخرة للعرب، كفى تشويه الحقيقة للدفاع عمّن هو لا يريد احترام نفسه أصلا، فهو لا يعترف بمسؤوليته عن أفعال جيشه وقوات أمنه؟!!! فأريد أن أفهم ما معنى الرئاسة وتحمّل مسؤولية القيادة إذن؟!!
إن أراد النظام ونخبته الحاكمة احترام نفسه عليه أن يعترف بأن هناك شعب يمكن أن يكون له رأي، ويجب أن يُحترم وخصوصا لو كان مختلف
ما رأيكم دام فضلكم؟

اسماعيل الناطور
05-27-2012, 03:06 PM
نتابع سيرنا حول شعار الشعب يريد إسقاط النظام .....
...لو قرأنا كلام ابن يوسف القرضاوي ...نجد إنه يقول أن جهاز المخابرات المصري يدعم شفيق وهو الذي أدى إلى نجاحه , بمعنى إنه وضع الجهاز في موقف عدائي للثورة وبالتالي هو جهاز لمبارك وليس جهاز وطني والمطلوب إستعداء الناس عليه تمهيدا لهدمه , فالمطلوب أقامة كيان جديد على أرض جرداء , وربما البحث عن اسم آخر لأم الدنيا ...ربما جمهورية مصر الإخوانية



حوار - سعيد شعيب

(جريدة روزاليوسف بتاريخ 9-4-2006)
لهذا الحوار قصة لابد أن تُروى، فقد أجريته مع فضيلة المرشد العام للإخوان المسلمين محمد مهدي عاكف، في مكتبه قبل الانتخابات البرلمانية بقليل، ولم يتم نشره كاملاً في الصحيفة التي كنت أعمل بها في ذلك الوقت، وكانت وما زالت عزيزة على قلبي، وقد تفهمت وقتها الحسابات السياسية، فكل الصحف والمجلات ووسائل الإعلام لها حسابات، ولكني لم أرض عنها، وحزنت لأسباب كثيرة أولها صحفي، فالحوار يتضمن كلاماً خطيراً، وثانياً أنه في تقديري وثيقة توضح بجلاء كيف يفكر المرشد ومعه قطاع لا يستهان به من جماعة الإخوان، ولكن من المؤكد أنه لا يعبر عنهم جميعاً، ففيهم شخصيات محترمة وتقول كلاماً محترماً ويختلف تماماً مع ما يقوله فضيلة المرشد، وأكن لهم كل محبة وإعزاز وعلى رأسهم د. عبد المنعم أبو الفتوح، عضو مكتب الإرشاد، الذي أحبه.
الأمر الأخير أنني أعتقد أن "موديل" المرشد تجاوزته مصر، ليس فقط في الجماعة ولكن في كل الأحزاب والقوى السياسية في البلد، وبصراحة أكثر لقد حان الوقت لأن يتنحوا ويتركوا الساحة لأنهم أفسدوا ويفسدون الحياة السياسية.
أعود إلى الحوار مع فضيلة المرشد الذي كاد أن يتحول أكثر من مرة إلى "خناقة".. وتحول مرات إلى مناظرة، ومرات أكثر إلى وعظ من جانبه وتلقي اضطراري من جانبي، ففضيلة المرشد لم يتصور أنه مجرد حوار صحفي الاختلاف هو قانونه الأساسي، فهو لا يخطر على باله أن من حق أي إنسان أن يختلف معه .. لقد اعتبر أن أسئلتي مجرد عبث ومفسدة وقلة فهم و.. و.. ومع ذلك فهو لم ينهه إلا بعد أن قلت معظم الأسئلة.. و"خبط بيده ورزع "على المكتب وقال لي "مع السلامة".. فشكرته على سعة صدره وعلى كل ما قاله وكان فيه الكثير من المفاجآت منها أن الاحتلال التركي لمصر لم يكن احتلالا ومنها أنهم – أي الإخوان - يبالغون في قوتهم وأنه لا مانع عنده من أن يحكم مصر مسلم من أي مكان في العالم.. وقال أيضا: "طظ في مصر وأبو مصر واللي في مصر".

وإليكم نص الحوار الوثيقة:

* موقفكم من انتخابات الرئيس مبارك كان ملتبسا وغير واضح؟

- "خليه" ملتبس.

* أريد أن أفهم؟

- هناك من قالوا إن موقفنا في منتهى الذكاء وهناك من قالوا ليس واضحا وهناك من قالوا "مالوش دعوة" بالسياسة أنه صاحب دعوى دينية.. أنا مع كل هؤلاء.

* هل أنت ضد سياسات الرئيس مبارك أم معها؟

- "معرفش"، حاجة عجيبة، بمنتهى الصراحة والوضوح قلنا مستحيل نعطي أصواتنا لمبارك.

* في التصويت لم تقولوا ستعطون أصواتكم لمن؟

- نحن أصحاب مبادئ تربوية، الشعب سلبي ونقول له اتقي الله في نفسك واذهب إلى صندوق الاقتراع وقل رأيك أيا كان.

* أنا أسألك عن الإخوان!

- مهمتي خدمة هذا الشعب وليس جماعة الإخوان.

* ليس هناك خلاف ولكن ..
-(مقاطعا بحدة) إذن لقد قلت للشعب اترك السلبية واذهب إلى صندوق الانتخاب واختر من تريده.

* جماعة الإخوان صوتت لمن؟

- "ما صوتتش".

* هل صوتم لأيمن نور؟

- لا لا أنا أحترم هذا الشعب وأحترم أكثر أعضاء الجماعة وقلت لهم اختاروا من ترونه صالحا ابتغاء وجه الله، "شوف العظمة".

* لقد نزلتم الشارع مرة واحدة وانسحبتم.. لماذا نزلتم ولماذا انسحبتم؟

- نزلنا لتحقيق هدف معين وحققناه.

* وما هو؟

- أعلنا رؤيتنا للإصلاح السياسي.

* ولكنكم قلتم إن ما قام به النظام ليس كافيا.. فلماذا لم تنزلوا إلى الشارع حتى تضغطوا على النظام؟

- المظاهرات ليست هى الوسيلة الوحيدة، عندي مائة وسيلة أخرى لإعلان وجهة نظري وكان من ضمنها المظاهرات.

* وما هى باقي الوسائل؟

- عندي مؤتمرات ووقفات في الشارع وندوات ودراسات وكتب ومحاضرات.. أنتم غلابة.

* أنتم تبالغون في قوتكم؟

- نعم، وسياستنا أن نشارك ولا نغالب، لسنا أغلبية ولكن لأننا منظمون ويعتقد الناس أننا "حاجة ضخمة".

* طالبتم بتطبيق الشريعة الإسلامية ردا على الأنبا يوحنا قلتة نائب الكاثوليك الذي طالب هو وغيره بإلغاء بند الشريعة الإسلامية من الدستور؟

- الإخوان المسلمين ينادون بتطبيق الشريعة الإسلامية لنهضة هذه الأمة ولتحكم مساراتها، والحمد لله أن الدستور المصري ينص على أن الإسلام دين الدولة وأن الشريعة الإسلامية هى المصدر الرئيسي للتشريع، فنحن لم نقل أي جديد، فهو أمر مكرر من عشرات السنين.

* وإلى ماذا تستندون لكي تطالبوا بتطبيق الشريعة الإسلامية؟

- أولا استنادا إلى النص القرآني وإلى أن الأغلبية مسلمة.

* وهل من حق الأغلبية أن تفرض ما تريده بالقوة على الأقلية؟

- ومن قال لك إن هذا سيتم بالقوة.

* كانت هناك تصريحات للعديد من أنصار الإسلام السياسي تلمح إلى استخدام القوة؟

- هذا أمر ليس عند الإخوان ولا في منهجهم، فنحن نحترم حريات البشر وآراءهم وقراراتهم، ثم ماذا تتوقع و90% من الأمة مسلمين، فماذا سيختارون؟!

* وهل من حق الأغلبية أن تفرض على الأقلية ما تشاء؟

- هذه هى الديمقراطية.

* وهل تنفي الديمقراطية حقوق الأقليات؟
- لا.

* ومن حقي كواحد من الأقلية أن أرفض تطبيق الشريعة على نفسي؟

- لا ليس من حقك، فليس من حقك أن ترفض قانون الدولة، والقوانين التي يقرها البرلمان على الجميع احترامها سواء كان مسيحيا أو مسلمًا، والبرلمان الحالي الأغلبية فيه فاسدة والقوانين التي يقرها يتم تطبيقها على كل الناس، وعندما تكون الأغلبية صالحة وتقر قوانين صالحة تحترم الحرية والعدل والإنسان فلابد من الانصياع لها.. وكيف ترفض قانونا عادلا، قانون يحترم الإنسان؟!

* القانون العادل يخضع لوجهات النظر.. فما تراه أنت عادلا يراه غيرك غير عادل؟

- العدل عدل مطلق وليس وجهات نظر.

* ولكن من حق المسيحي أو غير المسلم أن يرى أن ما تقوله فضيلتك أو أي مسلم ليس عدلا؟

- لا، العدل ميزان عند المسلم والمسيحي واليهودي، الحق حق، وهذه قضية واضح فيها الحق وواضح فيها الباطل، واضح فيها الحرية وواضح فيها الاستبداد، ومن يقول غير ذلك فهو صاحب عقل منحرف.

* ولكن معنى كلامك أن هناك سلطة مطلقة للأغلبية على الأقلية؟

- لا، سلطة في حدود القانون والدستور.

* ولكنك قلت إن القانون تصنعه الأغلبية؟

- الآن يوجد دستور قائم وهو الذي يصنع الناس بعد ذلك وهو الحكَم في كل ما يصدر عن مجلس الشعب ولذلك يقولون مثلا إن هذا القانون غير دستوري، أي يخالف الدستور.

* ولو أن المسلمين هم الأقلية في مصر.. هل من حق المسيحيين أن يفرضوا علينا ما يشاءون من قوانين لأنهم أغلبية؟

- يا أخي لسنا في غابة، ونحن أصحاب عقول وفكر، ولا يمكن للنصراني أن يأتي بشيء شاذ ويريد أن يطبقه، إلا إذا كان إنسان فاسد من الذين يدعون لإباحة الزنا والخمر وهذا غير موجود لا في القرآن ولا في الإنجيل والتوراة.

* عندما تقول تطبيق الشريعة الإسلامية فماذا تقصد بالضبط.. هل هي الحدود؟...

-(مقاطعا) لو أنها تطبيق الحدود فإنني أتمنى، فهى لا تطبق إلا في مجتمع يحكم بالإسلام، أما في مجتمع ما زال يحكم بقوانين وضعية لا تستطيع أن تطبق حدودًا.. تطبيق الحدود يا بني يتم عندما يصل الشعب إلى مرحلة من النضج والحضارة، بحيث يصبح لدى كل الناس قوت يومها وسيارتها وبيتها وبعد ذلك تطبق الحدود وليس قبل كل ذلك، لو واحد جوعان لا تستطيع أن تقيم عليه حد.

* مثلما أبطل سيدنا عمر رضى الله عنه الحدود في عام الرمادة؟

- لا لم يبطل.

* أقصد أنه عطلها؟

- لم يطبقها.

* لو أن الأغلبية كانت مسيحية هل ستقبل ما يفرضونه من قوانين؟

- نعم لأنني أحترم رأي الصندوق الانتخابي.

* هل معني ذلك أن الأغلبية من حقها طرد من تشاء من الأقلية خارج البلد مثلا؟

- ما تقوله كلام لا عقل له، هناك عقول وقيم إنسانية جاء بها القرآن والإسلام ليمد هذه القيم الكريمة بالقوة ويحترمها ويدعو الناس لها، "ما تقوليش بقى إن الأغلبية تقتل في الأقلية.. ليه هو إحنا في يوغوسلافيا أو البوسنة والهرسك" ولذلك ما تقوله غير معقول ويجب ألا أرد عليه.

* وإذا كان الله عز وجل اختار أن يترك البشر أحرارًا في اختياراتهم الدينية؟..

-(مقاطعا) من شاء فليؤمن ومن شاء فليكفر.

* دعني أكمل: أقصد أن الله عز وجل لم يفرض علي البشر أي شيء، فهناك من لا يؤمن به أصلا، فلماذا تريد جماعة الإخوان أن تفرض على 70 مليون مصري ما تراه.. فيهم على الأقل 10 ملايين مسيحي؟

- أنا لا أفرض قرارات.

* ولكنك قلت ..
- (مقاطعا) أنت تقول كلاما غير معقول ولم يحدث ولم يقل به أحد.

* سيادتك قلت تطبيق الشريعة ...

-(مقاطعا) تطبيق الشريعة أمر محسوم بقيم ومبادئ وأخلاق.. الشريعة تحترم الحريات وتحترم الإنسان.. يعني إيه تحترم الإنسان؟ يعني لا تضر عقيدته وخلقه وعقله.. واذا كان هذا شأنها فهل تضر الإنسان؟!!

* ولكن الله جل علاه لم يفرضها على كل البشر؟

- الله فرض الشريعة على البشر ولم يفرض عليهم الإيمان بها.

* بمعنى؟

- هناك من يكفرون بالله عز وجل وترك لهم الاختيار وهؤلاء الكفرة والملحدون عندهم عقول، فهناك غريزة سليمة للبشر، فعندما يقول المسلمون والنصارى واليهود الله الذي لا الله إلا هو.. فهل تستخف بعقولهم.. فالإسلام دين عقل لا يطلب أن يؤمن به الناس عن جهل ولكن لابد أن يكون الإنسان عاقلا.. لقد أتى أحد العلماء بـ99 دليلا على وجود الله.. فعلقت امرأة عجوز قائلة: "وهل غاب عني حتى أبحث عنه"، الإيمان في القلب ويتمتع به كل البشر، أريد أن أقول لك "بلاش" الأسئلة اللامعقولة التي تخرج عن العقل والمنطق.

* عموماً أشكرك على رحابة صدرك في الإجابة عن الأسئلة أيا كانت..

-(مقاطعا) إنما أربأ بأي صاحب عقل عن أن يسأل أسئلة ليس فيها عقل أو منطق، فهى افتراضات وأتمنى أن أجد في أسئلتك احتمال واحد في المليون من الواقعية.

* ما مفهومك لحرية المواطنة؟

- إنسان نحترم حريته وعقيدته وإنسانيته ولا فرق بين أي فرد مسلم أو مسيحي أو يهودي أو ملحد في حاجة إنسانية يتفق فيها كل البشر.
* هل أنت مع حرية أي شخص أن يدافع ويدعو لأفكاره حتى لو كانت تختلف معكم؟
- هذا اقل واجب يجب أن يتمتع به كل إنسان.
* ولو افترضنا أنها رفضت أفكارك مثلا حول تطبيق الشريعة؟
- مهمتي هي إقناعهم بأن ما أقوله عن الشريعة صحيح وأن هناك أبحاث ودراسات تؤكد أن تطبيق الشريعة في مختلف المجالات العلمية والاقتصادية وغيرها ستكون علي أساسها نهضة الأمة واشجب كل الأفكار التي تبعدهم عن هذا الطريق، وسيظل الحق والباطل يتصارعان الي يوم القيامة.
* واذا لم يقتنع الناس بأفكارك ماذا ستفعل؟
- سأظل أحاول إقناعهم وهل الشعب مقتنع الآن بأن الإخوان "حلوين"؟ فجزء منه مقتنع وجزء غير مقتنع وجزء منهم يريد أن يذهب الإخوان في داهية .. هذه هي طبيعة الناس، أي الاختلاف.
* ولو اختار الناس شيوعي أو ملحد ليحكمهم؟
- وماله طالما أنه جاء بصندوق الانتخاب احترمه علي العين والرأس.
* ولو اختار المصريين مسيحيا ليحكمهم؟
- احترمه، ولكن هذه أسئلة عابثة.
* يا فضيلة المرشد ..
-(مقاطعا) لا هذه أسئلة عابثة ولا يقولها إلا عابث يريد أن يوجد فرقعة.
* هذا غير صحيح ..
-(مقاطعا بصوت عالي) "شوف يابني قلتها في سي ان ان" الشريعة عندما تولي أمير أي ولي أمر فهو مكلف بأمور شرعية لا يقيمها إلا هو "حتى لو كان خمورجي وبتاع نسوان"، والنصراني لا يستطيع القيام بها في دولة 90% من شعبها مسلم، أنت تعرف ذلك، فالإسلام عميق في قلوب البشر وعندما تقول لي نصراني ترشحه رئيس جمهورية أقول لك أهلا وسهلا طالما أنه جاء بصندوق الانتخاب ولكن بالمنطق والعقل، "همه مش عارفين يدخلوا واحد في مجلس الشعب"، تقوم تقولي واحد منهم يريد أن يرشح نفسه لرئاسة الجمهورية إلا اذا كان يريد عمل "فورتينه".
* أسئلتي الهدف منها معرفة الموقف الحقيقي للإخوان وليس عمل "فورتينه" علي حد قولك؟
- الحرية في هذا الدين فرض من فروض هذا الدين فكيف لا نحترم الحريات؟!
* إذن أنت توافق علي من يختاره الناس بالانتخاب حتى لو كان ملحد أو شيوعي؟
- يا ناس لابد أن يكون عندنا ثقة في شعبنا. ولك عندي كلمة واحدة، الحرية فرض من فروض الدين أذن انتهى الأمر، الحرية مثل الصوم والحج وغيره.
* لو توليتم الحكم الآن ما موقفكم من باقي القوى السياسية؟
- يا أخي الكريم لقد أعلنت بأعلى صوتي أنني أحب أن يكون المنافس لي قويا ويجب أن تعلم أنني أنا الذي ذهبت الي الأحزاب لأنني أريد أن تنهض ويكون لها مكان في الشارع، لا أريد أن أكون موجودا وغيري ليس موجودا.
* إذن هل تتركون السلطة بصندوق الانتخابات؟
- السلطة يحملني اليها صندوق الانتخابات.
* هناك دعوى من حزب الكرامة لجبهة وطنية في الانتخابات التشريعية القادمة ما موقفكم منها؟
- أهلا وسهلا.
* ما هو تصورك لها وكيف تتم وعلى أي أساس؟
- لم يعرضها علي احد وحزب التجمع والناصري عملوا جبهة وأهلا وسهلا بها.
* هل انتم جماعة دعوية أم سياسية؟
- نحن هيئة إسلامية جامعة.
* بمعنى؟
- بمعني أننا نريد صياغة الحياة بطريقة إسلامية بدء من تربية الفرد والأسرة والمجتمع الي اقتصاد إسلامي الي إعلام ومناهج إسلامية والسياسة جزء صغير جدا من نشاطنا.
* هل تعتبرون أنفسكم المدافعين الوحيدين عن الإسلام؟
- من ضمن المدافعين عن الإسلام، فنحن لسنا وحدنا.
* ولكن هذا غير موجود في خطابكم؟
- لا اعرف من يقول هذا، ولكن لهجة الإخوان تؤكد أننا جماعة من جماعات المسلمين ندعوا الي هذا الدين وندافع عنه، وغيرنا هيئات كثيرة وجماعات كثيرة.
* هل تعتبرون القوى السياسية الأخرى خارج حظيرة الإسلام مثل الشيوعيين؟
- هم مجموعة من المجموعات بعضهم خارج الإسلام وبعضهم داخله وكل من قال لا الله إلا الله محمد رسول الله فهو مسلم.
* أيا كانت أفكاره؟
- نعم وحتى اذا كان عاصيا.
* وما هو سبب تحالفكم مع الاشتراكيين الثوريين؟
- ليس هناك تحالف ولكن هناك تعاون في كل ما اتفقنا عليهن فنحن متفقون على إلغاء قانون الطوارئ والتداول السلمي للسلطة.
- اسمعني.
* تفضل؟
ما هو السؤال القادم؟!
* تنظيم الإخوان عالمي ومهتم بشأن الأمة الإسلامية ..
- عشان نريح الناس ونريح الأمن.
* (مندهشا) الأمن!!
- نعم الأمن، ونريح كل القوانين الاستثنائية وأصحاب العقول الفاسدة وكل الذين يدبرون الشر لهذه الأمة وللمسلمين أعلنت بأعلى صوتي أن الإخوان المسلمين منهج مفتوح من يؤمن به فهو من الإخوان في كل أنحاء الدنيا.. هذه التجمعات الإخوانية عليها أن تخدم الوطن الذي تعيش فيه حسب قوانينهم ولوائحهم. إذن أنا قطعت الطريق علي كل جبار وفاسد يريد أن يحرم الإسلام والمسلمين من الخير.
* تقديرك الشخصي لتجارب ترفع شعارات إسلامية مثل إيران والسودان في فترة من الفترات؟
- الله يعينهم، "بقي ياراجل" البلد التي حاربتها أمريكا عن طريق صدام، هم غلابة وفقراء وكونها تقول لا لأمريكا يكفيها، السودان الغلابة ومساحتها قد مساحة أوروبا وفيها 36 لغة وحوالي مائة دين وبمجرد ظهور البترول أمريكا تمزق فيها، هذا الاحتلال الأمريكي ليس للسودان ولكن للمنطقة العربية كلها، فلا يجب أن نقول السودان "حلوة أو وحشة".
* (حاولت المقاطعة)....
-(ساخطا) دعني انهي كلامي.
* تفضل؟
- لا نقفز علي الموضوع، سبب ضياع السودان والعراق هو الأمة العربية والإسلامية، فلم تقدم يد العون، ولو فعلت ما استطاع جون جارانج والولايات المتحدة أن يفعلوا شيئا .. أن الحكام تأمرهم أمريكا وأسأل الله ألا يضيعوا إيران .. السياسة الأمريكية المغرضة تريد القضاء على الإسلام وعلي أي قوة يمكن أن تقف أمام إسرائيل، وهي يا بني 5 مليون والعرب 200 مليون والمسلمين مليار ونصف ولو عندنا ذرة من دم ومن أخلاق ما تركناها تفعل ما تشاء .. أين نهضتنا ، اقتصادنا، رجالنا، شبابنا، إنها تضربنا بالأحذية ومن يريد أن يتعامل مع أمريكا يخطب ود إسرائيل .. نحن أمة مهلهلة فاشلة بقياداتها، أما شعوبها اعتقد أنها ما زالت حية وأظن أن شاء الله سيكون التغيير من داخلها.
* قصدت بسؤالي زاوية أخرى يا فضيلة المرشد وهي المتعلقة ..
- (مقاطعا بحدة) "متحاولش"، أنا قاعد في مصر، لن تأخذ مني كلمة عن أي نظام في الأمة العربية والإسلامية يقلل من قدره، إلا النظام في البلاد المحتلة في العراق وأفغانستان أقول إن هذه نظم عميلة.
* ننتقل الي منطقة أخري: الإخوان يطالبون بالحريات ولكن ليس هناك برنامج تفصيلي، لو أنك توليت رئاسة الجمهورية في الصباح ماذا ستفعل في المشاكل الاقتصادية مثلا؟
- (مندهشا) يا سلام هل البلد خربت وليس فيها علماء اقتصاد، لو ذهبت الي المجالس القومية المتخصصة ستجد فيها قمم من الأبحاث والدراسات الجادة.
* ولكن الاقتصاد اتجاهات ومدارس كثيرة .. فأيها سوف تطبقه؟
- سأختار مدرسة منها.
* ما هو برنامجكم الذي علي أساسه سأعطي صوتي لكم؟
- "عارفه ولكن مش هقوله" لأن الذي يطبق برنامجي لابد أن يكون مسلم مؤمن به مش حرامي.
* اقصد ...
-(مقاطعا) أنت قلت بنفسك أن هناك مدارس كثيرة.
* هل ستكونون مع الرأسمالية وأي نوع منها، أم مع الاشتراكية أم مع الاقتصاد المخطط..
-(مقاطعا) نحن مع ما يحقق العدل لأنه سيكون من الإسلام، عندي مائة برنامج انظر واخذ ما يحقق العدل حتى لو كان من كتبه شيوعي.
* ولكنك قلت أن من يطبق لابد أن يكون مسلم مؤمن من وجهة نظرك؟
- أما وأن هؤلاء الناس الذين يطبقون المنهاج ليسوا موجودين الآن، فلا تطلب أكثر من ذلك.
* أذن علي أي أساس أنا كمواطن أنتخب الإخوان؟
- "مش عاوزك تنتخبهم يا حبيبي".
* المفترض أن انتخبك علي أساس برنامج سياسي؟
- "متنتخبش" إلا اذا كنت مقتنع.
* اذا كنت تقصد الشعارات العامة فكلنا مسلمين ثم أنها ليست برنامج سياسي؟
- لقد أصدرت مبادرة للإصلاح، (احضروا لي كتابا صغيرا) اقرأه ففيه كل شئ، أنا احترم رجال مصر واعرف أن فيهم علماء لا يقلون قدرة عن علماء العالم، عندما أتولى رئاسة الجمهورية احضر هؤلاء واطلب منهم كتابة المنهج الاقتصادي ويناقش علي المستوى العام ويقر من أهل الاختصاص وينفذه رجال يؤمنون به وهم على خلق ودين.
* عندي سؤال مبني علي كلامك ..
- دعني أكمل: منهجنا التربوي والاقتصادي والإعلامي موجود والناس أخذت فيه "دكتورهات"، عندنا العلم وعندنا القدرة علي تنفيذ ما يراه المتخصصون، أنا مرشد عام وعند الإخوان مؤسسات، مجلس شورى، مكتب إرشاد ومكاتب إدارية ومناطق .. أي عندنا نظام إداري: قسم طلاب ومهن وغيره، لجان متخصصة وكل هذا يدار علي أعلى مستوى من الشورى والعلم .. القرار يصدر بعد تمحيص دقيق من أهل الاختصاص .. نحن ندير هنا وندير العالم كله .. "مش هعرف ادير" منصب رئيس الجمهورية؟!! والمهم ليس المنصب المهم من الذي يديره .. رئيس الجمهورية يدير ماذا؟
* البلد؟
- الأجهزة هي التي تدير.
* بمعنى؟
- إذن عندما تنصلح هذه الأجهزة تنصلح الأمة، ولذلك عندما يقول الرئيس أن الإخوان يتصلون بأمريكا و"أنا مش نايم على وداني" قلت له راجع أجهزتك التي تكذب عليك، الأجهزة التي تعين الرئيس يجب أن تكون صادقة. أذن علينا أن..
* لتسمح لي ..
-(مقاطعا) أقول لك حكاية وللأسف الشديد هذا القطاع الصغير الكذاب الحرامي هو المسيطر على المجتمع والغلابة يعيشون تحت الاستبداد والفقر والجوع، علينا أن نوعي الناس، نربي هذا الشعب حتى يعرف الحق من الباطل، يعرف أن الكذب والسرقة حرام..
* ولكن يا فضيلة المرشد الذي يتولى الحكم الآن مجبر علي أن تكون له علاقات مع شركات متعددة الجنسيات ومع الغرب ومع أمريكا .. ولذلك لوتوليتم الحكم ماذا ستفعلوا؟
- عندما نتولى الحكم سأقول لك، ومن الذي سيأتي بنا الي الحكم؟! أنه صندوق الانتخابات .. أي الناس.
* أنا انتخب فضيلتك علي أي أساس؟
- يمكن أن أقول لك سأفعل كذا وكذا، أهم ما سأقوله لك في برنامجي هو أن تعود الأخلاق الي هذه الأمة ومناهج التربية والتعليم تعد الإنسان ليعيش هذا العصر وليس متخلف .. و.. وكذا .. كلها أماني.
* الجوع الذي يعاني منه قطاع ضخم من المصريين اخطر من كل ذلك؟
- برنامجي كله أماني، المهم هو العمل، ونحن لدينا نماذج، فقد نهضت النقابات عندما دخلها الإخوان المسلمين، أما الآن فبيني وبين الحكم مسافات كبيرة جدا، فكما قلت لن اقبل حكم إلا عن طريق الانتخابات الحرة، البلد الآن تموج بالإثم منذ أكثر من 50 عاما، إنها مغيبة، فقر وجوع وتخلف .. الي أخره .. حتى أصلح هذا الشعب الذي اقتنع بكلامي وأوصلني الي الحكم، لا أريد انقلاب ولا أنا "بتاع" انقلابات.
* عندي تخوف شخصي؟
- قله.
* البلد فيها 5% مليونيرات وفيها 30 مليون يعيشون تحت خط الفقر .. فماذا ستفعلون؟
- هل منطقي أن يأخذ موظف 800 الف جنيه؟!
* لأ طبعا.
- اذن المعقول أن هذا الموظف كفاية عليه 100 الف، وحتى هذا الرقم يغرقه، كيف سيصرفه، والباقي توزعه علي الغلابة، وأول كتاب للإخوان كان عن العدالة الاجتماعية وتنفيذه سهل جدا.
* تطالبون بالحريات ولكن التغيير في قياداتها لا يتم سوى بالموت ..أي أن عزرائيل هو الذي يغير مثل النظام الذي تهاجمونه؟
- لا يا حبيبي، المرشد العام هو مجرد شخص واحد.
* اذن كيف تطالب الرئيس مبارك بتداول السلطة ...
- ( مقاطعا) يا أخي الكريم هذه جماعة لها لائحة وقانون ولن أجبرك حتى تدخلها، ولكن الذي يدخلها لابد أن يكون مقتنع بأفكارها وقوانينها ونظامها الداخلي، وأنا اتحدي مصر والعالم كله بأحزابه أن يكون هناك نظام ديمقراطي شوري مثلنا، مسألة أن يظل المرشد في موقعه حتى يموت هذا أمر طبيعي منذ الخلافة منذ ايام محمد (ص).
* وهل هذه ديمقراطية؟
- كلمة الديمقراطية بتاعتكم دي زي ديمقراطية بوش نصب نصب نصب.
* ولكن ...
- (مقاطعا) بمعنى ايه؟
* تفضل؟
- الديمقراطية "بتاعتهم" شيء وما يطبقونه علي الناس شئ آخر، ولكن ديمقراطيتنا نحن ثابتة، أي أن الشعب هو صاحب القرار .. ولكنه لا يستطيع أن يقضي أمرا يخالف شرع الله، يعني لما "ييجي البرلمان بجلالة قدره" يسن قانون يبيح الزنا فهذا مرفوض، ديمقراطيتهم تبيحه وهم أحرار.
* ولكنك قلت أن الشعب هو مصدر السلطات لأن كل شئ يتم حسمه بصندوق الانتخابات؟
- "استنى بس"، نحن لنا مرجعية والناس "زعلانه" جدا لأن لنا مرجعية.
* غير صحيح ..
- (مقاطعا) "محدش زعلان"؟!
* اقصد ..
-(مقاطعا) "كلامك انت معناه انك زعلان" ..
* لا ولكن من حق أي احد أن يكون له المرجعية التي يختارها؟
- ونحن مرجعيتنا هذا الدين العظيم وهذا الشرع الذي انزل علي قلب محمد(ص)، نحترم الإنسان ونحترم حريته ولكن في ظل المرجعية الإسلامية، "ما يجيش واحد يقوللي ان الشعب بأغلبيته اباح الزنا، هذا فسق".
* لو هذا الشعب اختار ملحدا ليحكمه ..
-(مقاطعا) "استني بس"، أنا مع ما يختاره، أنت كفرد في الشعب تقول لا الله الا الله محمد رسول الله هل ستختار ملحد..
* هذا افتراض؟
- "ما تفرتضش"، الواقع يقول أن الأمة أمة مسلمة قلوبها مليئة بالإيمان، شرع الله يقول أن هذه الأمة مناط بها تنفيذ أحكام شرعية.
* فضيلتكم تتحدثون عن الأمة وباسمها وكذلك باقي القوى السياسية والنظام الحاكم ..
-(مقاطعا)...
* دعني أكمل السؤال: فهل سألت أنت أو غيرك السبعين مليون حتى يقول بثقة أنهم كذا وكذا ويريدون كذا وكذا؟
- ماذا يختاروا..
* لا اعرف، ولكن سؤالي من أين هذه الثقة التي تتحدث بها؟
- من عشرتي وإيماني بأن الناس تقول لا الله إلا الله محمد رسول الله.
* ولكن كل القوى السياسية التي تتحدث باسمهم تقول غير ذلك، الشيوعيين...
- (مقاطعا)الشيوعيين دول ايه!!
* اقصد أن الجميع يتحدث باسم الشعب ...
- مش أنا قلت الشريعة الإسلامية خط أحمر.
* هي خط احمر عند الإخوان؟
- لا عند كل المسلمين.
* حتى تكون إجابتك دقيقة لابد من استفتاء حر؟
- اعمل استفتاء حر.
* لو صدمك المصريين؟
- وماله سأقول لهم "عندي عشر سنين عشان افهمكم".
* أنا عضو في جماعة الإخوان المسلين .. ماذا افعل حتى أقيلك وأتولى موقعك وهذا حقي الديمقراطي؟
- يا سلام .. هذا موجود في اللائحة .. عندنا لجنة العضوية وتقدم اليها لتقول المرشد لا يصلح عشان كذا كذا.
* ومن حقي أن أدعو باقي الأعضاء ليكونوا ضدك؟
- نعم في كل مكان بما فيها مكتبي وسأكون فرحا جدا .. فهذا حقك ويجتمع مكتب الإرشاد وتقول أن المرشد لا يصلح لكذا وكذا، بما فيها أنني عجوز ومريض ويصدرون قرارهم ويتم اختيار غيره.
* لماذا في كل تصريحاتك تؤكد أنه لا خلافات داخل الإخوان وأننا كلنا نقول نفس الكلام .. رغم أن طبيعة البشر هي الاختلاف وهذا أمر عادي في أي تنظيم سياسي؟
- أنتم غلابة لا تعرفون كيف تدار جماعة الإخوان، فهي تدار بالشورى وهي يا بني فرض من فروض هذا الدين وخلق من أخلاق الإخوان .
* أذن لماذا حدث انشقاقات منها مجموعة حزب الوسط؟
- من أين أتيت بهذا الكلام، أنتم مغيبين.
* أنا أسألك؟
- أنا صاحب حزب الوسط، وباختصار نحن عملناه لمواجهة الحكومة عندما قبضوا علي مجلس الشورى في عام 1995 ، وبتكليف من مكتب الإرشاد وعملنا البرنامج وتقدم والحكومة رفضته، وكان هناك رأي في مكتب الإرشاد بأن نتوقف عند هذا الحد وجمعت مجموعة حزب الوسط وأبلغتهم بقرار المكتب ووافقوا ما عدا اثنين ثلاثة منهم أبو العلا ماضي وبعد نصف ساعة دخلت السجن.
* كيف تتعاملون مع حزب الوسط؟
- أقول لأبي العلا ماضي أنت تركت الإخوان وعيب عليك أن تشتمهم وأنت منهم، ثانيا اذا كنت صادق في العمل للإسلام، فاخدمه كما تريد ولكن الف باء العمل الإسلامي أن تتعاون مع الجماعات الإسلامية الأخرى التي تنادي بما تنادي به والإخوان هي كبرى الجماعات على الساحة وأتمنى من أعماق قلبي أن يوفقهم الله لخدمة الإسلام بالأسلوب الذي يريدونه.
* لو أن الذي يحتل فلسطين مسلمين من آسيا مثلا وليسوا يهود صهاينة فما هو موقفكم؟
- مفيش حاجة اسمها مسلمين يحتلون مسلمين؟!!
* الأتراك احتلوا مصر؟
- لا لم يكن احتلال.
* لماذا لم يكن احتلال؟
- هل ستزور التاريخ، سأحكي لك حكاية، ياريت مسلمي ماليزيا يحكموا مصر، والأتراك لم يكونوا محتلين، فاسمها دولة الخلافة وكونها دولة فاسدة فهذا ليس معناها احتلالا، فالمسلم لا يحتل مسلما، الاحتلال يكون من يهود ..
* إذن علي أساس ديني؟
- "استنى بس" الاحتلال له معنى آخر غير ما تقوله، أنت تعتبر الخلافة احتلالا، لو خليفة من ماليزيا حكم مصر لا يكون محتلا، المسلمون لا يحتلون بعضهم البعض، لأن يدهم واحدة في العالم كله.
* كيف وهو ليس من وطني؟
- الفساد العقلي والاستعماري والثقافي الذي سيطر على الأمة العربية والإسلامية جعل هناك ماليزي وتركي ..
* أنا لا اعرفه حتى يحكمني؟
- "استنى بس افهمنى كويس"، المسلمون أمة واحدة، ليس ماليزي ومصري وسعودي وغربي وشرقي، أنهم أمة واحدة، ولكن العقلية الاستبدادية الاستعمارية الواردة علينا قسمتهم، الخلافة كانت تحكم كل العالم العربي والإسلامي، وكل مسلم لم يكن مكتوبا بطاقته عربي أو غير عربي،ولكن مسلم، فالجنسية هي الإسلام.
* أنا مختلف مع سيادتك ويحكمني مصري وليس من أي مكان آخر؟
- طظ في مصر وابو مصر واللي في مصر.
* إذن أنت ضد الاحتلال في فلسطين لأنهم يهود وليس لأنه احتلال؟
- لأنهم محتلين ..
* ولأنهم يهود ؟
- ولأنهم يهود وصهاينة ومجرمين جاؤوا من أقطار الدنيا حتى يحتلوا هذه الأرض ويشغلونا بها.
* واليهود الذين يعيشون في بلادهم هل أنت ضدهم؟
- من أنقذ اليهود من محاكم التفتيش في بريطانيا أنها الخلافة الإسلامية، أي الأتراك وكان اليهود يعيشون معنا هنا مواطنين عاديين جدا، أما أن يحتلوا الأرض ليس عندي سوى السلاح وكفاية اتفضل مع السلامة.
* أنا شاكر على سعة صدرك!!

اسماعيل الناطور
05-27-2012, 08:38 PM
علم "اليوم السابع" من مصادر مطلعة أن الفريق أحمد شفيق المرشح لرئاسة الجمهورية حصل على المركز الأول بعد الفرز النهائى لأصوات الناخبين، متجاوزا منافسه الدكتور محمد مرسى، مرشح جماعة الإخوان بـ 160 ألف صوت. وأوضحت المصادر أن نتيجة الفرز النهائى لأصوات الناخبين سيتم إعلانها خلال ساعات.

اسماعيل الناطور
05-28-2012, 10:40 AM
قراءة سننية في أحداث مصر الراهنة

رؤية مستقبلية
وهنا أيضا برز غباء رجال التصوف المساندين له بدعوى أن أباه كان رجلا صوفيا، كأنهم لم يقرأوا يوما :

{قَالَ يَا نُوحُ إِنَّهُ لَيْسَ مِنْ أَهْلِكَ إِنَّهُ عَمَلٌ غَيْرُ صَالِحٍ فَلاَ تَسْأَلْنِ مَا لَيْسَ لَكَ بِهِ عِلْمٌ إِنِّي أَعِظُكَ أَن تَكُونَ منَ الْجَاهِلِينَ [هود : 46]}

وتجلى هنا جهل الصوفية بمعرفة الله بمساندتهم لعدو الله الذي في عهده قتل المتظاهرون ووو... فأية معرفة لله يجدونها بسقوطهم في نصرة مجرم يتابعه القانون وبعلم الخاص والعام؟
.
الأخ محمد جميل أن نكتب كلاما عاما وفيه من القرآن ما يريح النفس , ولكن عند التدقيق في الألفاظ والمعاني تكون الصدمة
فلقد وصفت الصوفيين بالغباء لمجرد إنهم إنتخبوا أحمد شفيق ووصف الغباء لمسلم لإنه إختار بحرية فيه ما فيه على من تقصد , ولا أعتقد أن السنن تبيح ذلك
ووصفت أحمد شفيق بالمجرم دون محاكمة ودون دليل وهذا أيضا فيه ما فيه من إتهام مسلم دون دليل وخاصة أن المحاكم مفتوحة الأبواب لكل من يقدم بلاغ , ولا أعتقد أن السنن تبيح ذلك ,ولكنك وفي نفس الوقت لا تشرح لنا تفسير السنن لموقف التيار الاسلامي من بعضه البعض , لا تفسر لنا كيف أن الإخوان هم أعداء لبعضهم البعض وما هو سر العداوة , الهلباوي ينشق , ابو الفتوح أخواني ينشق ومرشح رئاسي ,وابو العلا ماضي أخواني منشق ورئيس حزب وعصام سلطان منشق وعضو مجلس شعب ,ومحمد مرسي بديل الشاطر وريس حزب ومرشح آخر, ولم يلتف حوله أخوته بل عادوه وعاداهم علنا , وابو اسماعيل سلفي ومرشح آخر للرئاسة وليس مع الإخوان ,ومحمد سليم العوا رجل مسلم ومفكر اسلامي وهو مرشح آخر وليس مع الإخوان ,وعبد الله الأشعل من التيار الديني ومرشح مستقل وحزب آخر, لذلك أخي محمد أرجو أن تقرأ السنن بطريقة أخرى , فليست المشكلة بين شفيق والإخوان
وليست المشكلة في غباء الصوفية كما قلت , المشكلة كانت ولا زالت وما زالت بين الإخوان أنفسهم , ولن يمكنهم الله في الأرض إلا ليخزيهم إن كانت سعياهم للكرسي وليس للدين .
أخي المشكلة ليس في شفيق ....المشكلة إنهم عن الإسلام الصحيح إنشقوا , فلو وضعوا أيديهم في بوتقة الاسلام الواحد لحصدوا أصواتا إنتخابية جعلت من شفيق رقما لا يظهر
قال تعالى لعباده "ولا تنازعوا فتفشلوا وتذهب ريحكم" وهذا ما يحدث الآن ، والسبيل الوحيدة هي "واعتصموا جميعا بحبل الله ولا تفرقوا" ، فإذا لم ينته النزاع فالفشل قادم كما تشرح السنن المحكمة في هذا الكتاب الذي لا يأتيه الباطل

اسماعيل الناطور
05-28-2012, 01:55 PM
http://www.almolltaqa.com/vb/image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wceaakgbhqserquehivfbuvfbqvfbuvfbqufbqufrqvfbqvfb uxhcyefxkjghquhy8gjccplcwsfr4xntaqnsyrlckbcqokdgwo ga8pfykchrwpkskpkskpkskpkskpkskplckpkskpkskpkskpks kpkskskskpkskskskslcwplcwpkf/aabeiammbawmbigaceqedeqh/xaacaaabbqebaqaaaaaaaaaaaaafaaidbaybbwj/xabaeaabawieawqhbwiebweaaaabaairawqfeiexbkfryxgboq ctijkrsceuqljy0ehwi2ivgplxjdndu7lc0hb/xaazaqadaqebaaaaaaaaaaaaaaabagmeaax/xaameqacagicageeaweaaaaaaaaaaqirayesmqrbmijryyetm3 eu/9oadambaairaxeapwd1jqr3o4u7vxuesnyyoooyq3ssu5ktcqs 7hzxju1svavnbogjax0vukzv2vvqkojqg6ihd6o6inkdcuim+8 pwohe8p2p49cskapzutvjkyuce8knptwuqejuy4qanjjaa3jtp ws43xetyw8j2xinl10qbokvuhxvhlkyjpszgaak5qe4rjhas5f 8fvkmhiaojt9uequx3d5iys2a10bycsf4k1uw/dzj5ubsfjtroduxt7wzplqsfmodc4m8bpj8sfiq5wsogkivcwf q/vt52x/go6muj3i71btsvc3zx25okdvajb2uwug9o5omtep8g1sulxjcl 0fzvaxc+nqezpb37ffev07ojx4lxansdt/jhk0i8spb7beqdrkseco9tucvgrtex0sc1xhdovsmf4vejof3h xvvotrnnian8cugkrz3bxtlplwmqxcqemj5tyxhchjdcs44htv e55ky0kg5sdezgiq3qvohvbsqs7hzvu1uovpbhmakqdtwvynvu psqykohut0qy1uky1rfqddhojd7ymafe73lzatr6fyot0l0foa 6e+fgfkwlrfily5dgk/ybvkwgkxp2ipmc0wngg8loujb32vvtokdp5mpouj9sdrg26xz8 m+kpt8xbrkwf6sjylhfpqcr76c7bdu80gb9t+iyhprocvqbi2v m0gbaeai3cvmw006fuhz2ep6rjqqgrugiepvr1fgk9dxsq+6yw jutpiukkjqi/vtwdlk7ftmfft1vogaggdjhxqqpmbikwajsdoa5fuqdz8fpboj 8kqhseayd2nri5qjxrdy6rr4c/1vkmbzpoh+jn0nqdy+ul0rcsuzxbltqnwdx4lxrlyblp3gdekj bwwtwpechsqmcs4esorbbznkvcrnngz0twtqmw1017q4c+skvi b2ek5cxha5guf1yu7fbdnzimrkaktdhwqdfwuipooyqprzrka2 kipk4akvctvnlvlfhejnwrzsqdnwidgomkgo95wwlv3jvthfcs dmtg1na1shogcae6tvdgfx5an4lgcgcq1opho+8fian6jjuk2n cpksrnas8l7t3ekypqw9b06f7qn40ktpgpkro4msos8wei81uz 3i6vedzpkdnp2aqmvb+in4pl08azlpxvx7rm6rolkobct1gsr1 ujprvturgzmrqkcck74oiqxrzaht6q5fojruhbbuqllc0cndkh rpkqjv5xkkn9vi0visjjwgftusiatiexokyu3nqtvuy8ih7/br3vhwoeqqvgdo6qe/fzla4mgs2xbvjajeqt4ag/qthwvirgf0nkq3nrsfhnxpdjy/2ssstykhfv69squsz77gl43mxrdzzr3ioxiti1ex8i3d3uy6ce nyoncvtbc+yj3txzcsjul1jmidgfqxeylbun1skgga6kvchwwj rq3sl7kmpht2ygkntt0wcapsqskzuvfmuqbzbqeszshzn0qbsu kmhtt3lo1qv3u7e0rgpcce0jraskgcvgmbri98ak7aenualeaw 3h7liu8vpyadlydzexhevr69jxy/3dinydrpoo7v4digauzuiy8nqg7z2w5wmqaeanlwqzfb3aptsz xmkhts6bsumdktzjabme9pwo4xrvfti8vmc2d7vxl2ruxnj+ut 9x6watujhwzwfwt0j1fprrxveqltjfgm8ejs1q9nffq1kvqnb6 jwfgsxin8azi1hgcqbh6kiofh5/bftb0ouzsdekc1ry17juc/rr6gm0awjpv8a53kxoqpxds5idtwmufaafa290gkzt8qd4kjkk vrwm5vsmr1mx07vxazrchulidi05qs2rtqcjvdxysu/yk12u/f2lln8lypetijg7ez5poqyc5cutpqjmhhbuhwj38ele+bg2uh7 jlfkjfzeik6ebb7uirszb1b5jnbwqkme3bkd9bgezp07iqzly7 zpp6qxwr5mwd4hv7w62hapqpqqomz1f0zxpewn5sdhagnq6/beqnggxkfoadnq128mhp+i9fypoqieuxzuk8jjhqoffcjrsnuv yderho406kg62ujdlhc7khsf0uiprd2qhu1tumat1boqyuogiq wmqwdbuidah7dwitdkjhi5ugqmafdv3cmauyimvrpiibgkqd0p xwwou+erqomv+i1gmsm4zdjz1dxalaku/r3fqo8ivzydggpowrhpdsuuxbwioni7jvxwvvoexbvexjm1xnd 71zgdmnx49f7rc3dwmze6dudvyfjklqxuc7qzittj1oillyvsn fjy+vtgzbtvc4tc2k0tbmty0qyaaihlxtukh4hx2ox+qzawq8u 1bed7jabmgjgipvc2kohihat2off4e2s5rndy/ry1kfkzcsaqgfglihvqc4tbewqbjvy6wxz3++qpagjocxnggom goipnajdmaghodf8akohze+9vzhp99uvk3zvq1rjuf2vklcuql d7ghrs7qjc4bbmaqrgnmi+n0bsffeuuraligbgextjmo99jz+f 2u/q9qpxvvlca3nv3qmlkt9e44xh2yjha7mzxnovbnai0vw34ldtg tru+j/8albu+tc7muwb7al3siqfelqjrngcaporxlemzetxgnvuvbm89 fmkookcsgnpinvohyohed4thhvpnqaqj33ma6+arfw+xmyxn9w th3eyq1bmkciecbwrxu2pbimyza7ijpjkfyhh7w1whoirj5aey pje8vu2w9jjbcaofoxxj21hpksxqkmbfyoqyzudqqgtebzg0nw q6pqcx8o6ycnqjywd3q/w1ss466kqzjghnno2sbrin5jy5n7kywxgzr+guv/xdya6gkdhuhwxuk8k9a1qtd1ntoylr2lzhhyxuq1hns7orq5ks 4uchr3gyefhce6pj2rsoizc7bobsorl2ikux/rvnsqyw4lb9o9tubkjmnm6exmihvfedq864rxamuwpk+zuazhq oaz8ig27o1ycuzqbz6didxlyqhzxgy66brm8j43uqvruqpzfko aeeumipva28w/ah1amwjkxv4wg6eoklw/r3qln1633sqwehto+yxjtyglbrw77ny06heghqiezkidbonky0 kodvk1q1dwpmjl0iyqfcewfdxyrazzgmpnqnaswgawdpmqojqi euo3zrder/un+0euos3gmcqy9kndycnypywf1of447tuqdudwzgahmm/y8/qruicr27znd4bpujun4bdrmvb1gf1m8pghhbzscx7nklf6nztq ksbeojadqqve6ddch3qjgbe3opmdmulz6jfxwtqaedirokyeqx tnbn/nwvc4ovjo47h+q0l6jrigkitf3ummkj+quong1hygiy69qfylw eypa1bqk96b3dexj4xjnpfitdqauku8wmzeup9zwmwqnalpmk8 vrdi7icrnuzmdgpaqb5bwkb6zukbaklsdlb+8tod2stdgnswaz uts7+dkqssykh1nzts85sok6fhlysvrul6matjzsnqdt2lp/ag8f4fupu3d8oc2tvcmbbmo7rwys7pt9vhub8kn5f0qz9z1hqp hitek/p4qekhjsr5gtjh/t130r8m/zripciqv/boken2y0+gvityfyntdwhoeacaogxwr0uei3y5jjjcaatkiunl kxrxj0uylebdoqekvipnkymgd4aq3t2qffb4erqhkawhzpgnbd ll8gahernuahdgem4m/nm1zr3alay3itqj5pjdumrmvipvphl/uhf1xkjttwt7zrnjjveu2tctpkdd2nxxtma4cle3p0hyact1cr lie2svj+emo9fd0af3q7o78rbmpyc9qdun9mpllvdmo2rjmwqx nje6ewxmihtyahssuvxckammqjjaurhskiabj9xk9ppnvyp7rn vkaftii1cse5axiqhlwhti+in6lj1b71zayz2kx2lflx16pw8d 3jsbvtgrj6gc909auy/wdzlmngtjjqdb3bnpy2pwhfx2h8ivpukscdbjso6dt9llgiw1p hgdqa1o0gak/a3msjpi7uf+0synenfctxq+oonxcmyktmjvob5qgvv5ce/wakaxecusfo0b0so5g+/caceadquvvqmy66dfvruogythok1zrc2sor8w2dvzv1ji1keyl wkqsdit0ghhtxv21kbxzxpyid4y3cfjf7+wt7ggg+zuq7lwg53 +cl4lomfavr73rhtpdoh/fv8xubyvmgdk7pbuvbsqpihx+nvktabxdky07xn9fv/qlhtc2vxj2w4ux+uidpgviw99uggtgjqplxx0d6icafbwr9yid vfnjmblaervccspoz5hi27kguuc5kqztsjjarq44zwcobnzsnu nydfjlblm6lly3zrbvymjnno8rrvxh1bin40+cz2nxuwrpbkjk ss+z0pg6z43cchekvkjeo5t3r9qtzlrmjc+ggkmaansstt2rsu hzdnpnohw8f8rwi1gwm09mrnr8avqduhfceecztgmeqhh2qhja 9t24k9nb4k5sv6b3emqmcejxan4bayzduy01e6wyfheqttf0he dqnukrp2uvbkpghqj4itky4susuwmadseozqj/tlxechyxnfe2hzn5rognq84xqnxszncoopy0xn+izpzdedismb ttpr8v/s0y7dogmhnrz3y4kzijae6gqd1cumo5nc4mdfz2hiisj7ll5/wcm3vaaxwl8reeeqppizakjp2l61i5qkfoi747sthysdi17drr kp1mpkd/y/vwskinlez1htwu5sskwxt/w1qy5flty8dvzfbw54hcmvng+cvfgbau6jqoljhrk8fbk6jja2 vppm7kywilzvrp1jp80evnaohfxcajqufuaklxgjpkkie0xors a5rhknczihxqqtv5csssseqc0rgcqkz3j1r6n6hoggv67qtroi pqqd+mnttsxu9jgagl5m9hekvkwjunmcw0w5ran4xncq0gjnv5 l6acqkypvzxyzckcmiiiljjjcczxpunydcpffcbktkfk8qrsd2 wou5/zasdrzbdxibck31fvrbv7x7th5lz/jgm51di0hu7rjl5hp+oqhz5je+08ls4vfm2rcqxrxoadklhia4/fjmrytq1hlio4krn13wlde5ldhapitwu7pwqf7j1pygwwr4cwl j2cotdp0gwrhsnv5/b3dhids4jsqcfkf6fwth14arz0wxgn1ef2xunxajjtmjjxb6gh kjhtnjsxksz3xcobyeip+oao1w9xqy4c6nllkrrjatmjq081nl eo9jnevpoyjeo0ipicm1soirtr03lpydxrp29r2ksljomunhhn xa9aq8lntwxbxox0htnziym+oabo0hmjue4kyvtd2hsscduhdc h4rtcsz508uoq2i8njqeqqero3wrxo2io8f3go52v1wuczhe00 qoerlhqzhijq/rzs8bjo2ejjkdmpdducx3bpfty6gnefrjummggz1tkukmcdewv islhr2s1kqdud+1evi2a0b7fyvmwktoniblpvswe5t90embyrz o0zuqu6aqteaoay5kpy38znhmguo43mgbj4wbzn5ekq4tegu02 cov8ueqonmh1auxfrbslbfcjfkb9dq1yxfmpui47feblb8250r uycfdy2sdaansi36qodatmflyvi1wqpu191n4j/69vqlthmu/brwtyypdh5jzpzso8queq25ak0cf3ms8ivrxw5ooloyigg9pim yvdueonkn/tlqrh7dlq0z7zhfugncva2vvphdiw2okcsd/tduy1rydtcqhfcz8e9egz6okyskypibbkesd1b28lx6uaklwfj cczskk4doe7yt8yhuvdpcfkpff2dcnaxs87kztsoqupejtkuog ygya8o9wsasdua9rltywor7evpi8yxxkocn9uhzctfr+jsldc6 n1k20qt3rrb2jpkvm9y4i4fbbwjblhrhta+q4hnlyor6dbtojd jqvkeeelq1r/td/uo/hj938h5dy9lscsbwah0zipxb6htrsyzhjblbqqcicaqdwdlmma w0pdktnopgh2zmtpy0cu9g8trnkwn0crv0cew5ymlx1bvy16qw sxpgvxcb+tih27lwiwmlz37k7ueya8fs+hchftqbtmxsxppv7v e8nh4lzjcl4xgi0mtlqs86/ge/of6xsoypjjrlyp3olatlhuugteuc1veqpmhd5xhz0vfuqq7m4j +avqmegtzxlizbvywpbmaex1hqre33phw9mz31d/yw/modfen2mp+tboj6vfa+dv3gwxxrooipr7uac+0qexqatyjp5h9 ewra3v5xpplxghw94obb8qrft6wmqvaop03u7dsfz3nzmlkbrl 3s6dh5kbvekumjxmim0tyid3kmo4dm5w0k/vh/m5k0wj5mlpshr3lwpuqaqdukbex8p3dqla9bmem9ge0tchogju fp1kgrp0wwdjtphzrvb3b7vj43htghzvl2xa16ebtfqrvi49it g3ziw692qvoy5ltb2yrrozyrnc8hljtor2b4shpay5jmab+s9e wxhcnaduedgrlynqiz441cjo4vwy5/utyt5up81rptjttx7i15uo58foi97cgey3qdoszjf5ywygfy1b 7motpljr0dszvfma1wsrwjxulddvg5rbskihe7ziw9tofk8+sq 5il7nd2dzuejoppd0n8bi6trb1hf1qdqbj9+kngu7xod4l0vfh wc4xvtazk1f5y9hkeeypuear2r6d4j9l9vemay4c2hx2ijim/ta47t0kdaehqulgm6jblqekpxmxfrvzoe5suve7fdhhocpmogl glaznh+4/pkjwimgnloejwrhgvulwmvq7trp6hymz1o+jbcws5rdnazkl0l i5uh0gcgsb6v8aqa9dfxf0dithozkadxwry2a/x1b3uzhjxbm7fvwaice7uhecvu2gabjzk270pqth3h25cail3e 6kojmnnjgmeshcxyqwtm5eybbgnvcb4vxiazcyrlej7ndr2fzb itgjuda08fimhjblsxjmjgjzd+kq1tvduoloewluygoibmmj22 t7zj6+q+9dvy6b2ufbsloykxlclr5epcnzar4juezfue78znh5 lv/wkpmuheuc12qldve0j+zca1nbtmglenmknmf5twbmhxduzfbfm 6bwpnc4afnats/7tvva7xmlao/8hihcwbqup0wjzeupcfqxfghwewybwtzawv2qsdcgtnmeaztxa jfmhaz39v5f6vckfdexlohtvjkmm2yjk7zbpit76nsbforurhk 3jpze6/iiv6ymnfvyy5yaeroq9jhh2se50/6louppahg/qposlucj2nkdhdqfua2fuwwuqenh3to/cbv8lmoesf+0voi9lrs50dbs3xonxw9vof31cxpiaa5e7hqdfm hg5u2bj5v41smnwxbdlafvike87vi2hyeu4wx2tbuyvhf1fx9p pjjyfxsny9mxvihhrdvfnvieuigboappkitmczlbccsdqpl5lb cmyrrilku9ssypfzsrm7eeboa7uedhwyxg8mue4lscy2pvaji7 1z/i4zmfahw8vjbirissoskd1v1qte7/ao6pfw8ru8ojwcc+st1umwncvxdhibkaqtw8hnxsuodntxjemy gsuqzwgqgiq8adsepiielxx9uocq2i60n/ajxfjed8f8w3p2g21o/ignms5szsx5a8o0wqwwlwr31kluukr25muexoepzgpee+ci6ov glb0j2pdnh1y05+oyddtbim89krp2qdnosoxdvap80xns9akmv xpqd3lbxjyipt6lcyxctmrb4jcsyv8sj5mxre/warphptwivarff0fx6g+dzqr7xcqxf1oyuogweufwvdg+qpodo 6bk4srpuy5sbokppssrehajwxauondk4jrqninbthq+9td0kh2 bvzm/ktld5er17ascygvuduhoo05/c0y4jvmdwxinnhjagpjahedaf9mvajbspmfgztngfaix5rmpxl vxsdh8ku8jdpvr56rl+lpm3mz/p1kcn/mdk2ed04ahngdnlzjkzbnehagh3qorz07extbi6dnnxa9madn9 r3s+sia38rtlnd3l4ozivet3j1votoga94/srjw4udhm/dagmy8+5orvcuh2umgxqbjj3mbncpfhtnyypwlavvs9vv79xxy hjnd89vpltcns5/87fywyx3e4b6x0hikfelnki2sn7orn+k2cpbvayh3c5vewh3yb xkfd+kr0w/xuuuabw6jma78plrvirznhx6g1gn7j3n+bih0syd0zffa8vjpv 3qinomkk801tajibdxedhwsjhnlkgxe4bcskhjccbhaxesvazn +0t6wknmfwffaninxklleswbd5ssxn5pl+j1vh/r/z6rqeqw6/yfn755115pjkc6njhcbrgxceqynv2psswvey/ib1cprlxjakedlsjks4kikjjjje4ef0jjiheklqsskod/aajqa/ebrrhineni7ji8wf9c3opm9ukk8afyy0cz15s53otr4pjkyawm deyt0co1gagafecssb0d2wjss9jlzlpikkolf2zpawb1yk6n91 576u9l2obsxzhbkavxjb9hpsxq4uklnaeemrqs5hcxqujljh6s ss4j/9k= http://t3.gstatic.com/images?q=tbn:and9gcqwetagfzidegbi0rybquvjz3gjy7pdy kvroxje_hikm1hf9kidhttp://1.bp.blogspot.com/-_9eyg1xt4hw/t1f8z3vaxgi/aaaaaaaaafs/jjhgoej7ezs/s1600/19.jpg

نداء الدماء



أهانت عليكم الدماء ..... أي زُل هذا وأي مدى للهوان


يا بلادي إتحدي وبنور القلب أمضي . والله اني لا أ؟عقل أن يعطي اي عاقل صوته ويضع هذه الأمانه في غير موضعها مسيحي كنت كنتِ أو مسلم والله أنها لمصيبة أن تتخذوا من المجرمين حاميين وأن تلهثوا حتى ترجعوا وتعيدوا ذات الفساد وعين الزل والقهر


أليس بقائل سيحرق الميدان على من فيه


ألم يبدي رغبته في الإستعانه بزبانية النظام السابق


ألم يقل يومها مبـــارك خط أحمــــر ............... ألا يكفي هذا


اي هوان واي عجز هذا


يا رجال بلادي إتحدوا .......... فقط لبوا نـــداء الدماء





قرأت كل المشاركات ....
ولم أجد الفكرة التي تجعل من المواطن الذي إنتخب مرسي أن يغير فكره
...ولم أجد الفكرة التي تجعل من المواطن الذي إنتخب شفيق أن يغير فكره
....وهكذا ضاع الوطن طالما أن المواطن إما أن يتكلم مع نفسه أو إنه يحاول قتل محاوره ....
جفت العقول وكسرت الأقلام ونجحت الفوضى


أستاذ/ إسماعيل
الفكرة واضحة لمن أراد أن يرى
عفوا ...أنا لم أراها واضحة , لذلك أرجو أن تكتبيها بسطر واحد ...لإنسان لا يثق بقادة جعلوا عنوانهم الاسلام , ويتصرفون سياسيا بأخلاق أهل الساسة من كذب وتحايل ورشوة وإتفاقات ومصافحات لمن يقول ديننا عنهم إنهم كفار , وأجد البأس كل البأس مع أخوهم الذي ما زال يقول لا إله إلا الله ولكنه تعامل مثلهم بالتحايل والرشوة والمصافحات لمن يقول ديننا عنهم إنهم كفار , ...هنا أجد أن الفكرة واضحة لمن أراد أن يرى <إذا كنا نختار من أجل الدين فالكل رسب في إمتحان الأخلاق, وإذا كنا نختار من أجل الوطن فلنا أن نختار على أساس القدرات

اسماعيل الناطور
05-28-2012, 08:18 PM
الأخ مصطفى الشرقاوي
الأخت جلاديولس ...
ليس هكذا تقاس أمور وطنية إستراتيجية وليس المقارنة بين أشخاص في العموميات, لو كنت تتابعين ما أكتب, لعرفت أن خياري هو محمد سليم العوا الذي يمثل الدين بنظافته واستقامته واستقلاله عن هوى الأشخاص والجماعات , ويساعد على لم شمل الوطن وجمع المتدين والمتحرر في بوتقة حب الوطن , ولكن ما دام وكان العوا بعيدا وخاصة من الاتجاه إسلام سياسي , فنحن إمام فصيلين كل منهما يريد الكرسي , والكرسي هنا ومع أحمد شفيق أطمئن عليه بقيادة الدولة المصرية جيشا وشعبا وإدارة وعلاقات خارجية أما مع محمد مرسي فأنا أعلم إنه طريق مظلم , وخلق السبب لحصار مصر وقتما يريدون , وخلق السبب لوضع مصرية واقتتال داخلي , تحللين الرشوة باسم أن هذه جمعيات وعمل جمعيات وهذا شيئ غريب , الرشوة رشوة أختي واستغلال حاجة الفقير وسلبه قراره الشخصي هو جريمة , أنا ليس لي صالح مع مرسي ولا مع شفيق , ولكن من جرب قد يكون أعمق فهما لمن لم يجرب , الدين في هذا الزمان يجب أن ينهض بالأخلاق ولا يمكن جره إلى مزالق الحكم والتلاعب والتحايل من أجل الكرسي , صدقيني لو وصل الأخوان إلى الحكم فإن مصر ستدخل في نفق فوضى قد يطالك يوما ما , انقسام الشعوب وخلق العداء بين أطياف الشعب هو قمة المأساة , على محمد مرسي والإخوان أن يمنعوا شفيق من الوصول للحكم بطريقة أخرى غير هبل وصف الفلول والشهداء والكذب , عليهم الوصول للحكم بالبعد عن كرسي الرئاسة بالذات , وخلق ائتلاف مصري محبوب وقوي من كل أطياف الشعب , يوافق عليه كل مسلم وكل مسيحي وإفراد الجيش وحتى أولاد الشوارع ....هذا هو العقل ....إما هذا الطريق....أو تسليم البلاد لشفيق والجيش وخاصة أن الرجل نظيف اليد والجيش هو عماد وحدة البلاد , أما الدخول في مهاترات الفلول والضحك على الذقون ودم الشهداء واستغلال المشاعر هو وصفة لهدم بلدكم , كما حدث عند جيرانكم



للجماعة لجان ربما لا يعلمها العامة وهذا ما تسمونه أنتم رشاوي وعطايا لزوم الإنتخابات والباحث بصدق سيجدها دائمه.
لذا فهم لا يعرفون الرشاوي سيدي
التغيرات من أركان السياسه فلما التجني إذن.
أستاذ / إسماعيل
المحايد حقاً يعلم تماماً الفرق بين سياسه نظيفة يلعبها حزب الحرية والعدالة والسياسة الملوثه التي يلعبها غيرهم.
أختار على أساس القدرات
هل أختار من حمى مبارك وقال ....... مبارك خط أحمر
أم من عارضة وصمد طيلة 30 عاماً
هل أختار من نفى أنها ثورة وأنها مجرد حركة فاشلة .
أم من دعمها وخاضها وحمى ميدانها
هل أختار من قال أستطيع أن أفض الميدان خلال أربع ساعات .
أم من قاتل وقُتل في معركة الجمل
هل أختار من رفضة الشعب أن يكون رئيس للوزراء
أم من إختارة الشعب ممثلاً له..
هذه هي القدرات أستاذ إسماعيل



أ - اسماعيل السلام عليكم وتحية طيبة ....
ليست كل الأمور تؤخذ هكذا وتبقى المعارضة في أوقات لا يمكن للبلد فيها أن تحتمل الإشتعال والمهدئات كثيرة " وأهل مكة أدرى بشعابها " أنا لم أكن مع الدكتور مرسي من البداية لكنّ الآن فقه الواقع يحتم علينا أن ننصر من نراه صالحاً وأقرب لنا من غيره إذ رضينا بالواقع المُعاش فلا نرضى بالواقع المخطط له أو المجهز مسبقاً ولا نرضى أن نفدن رؤسنا في الرمال مرة أخرى ونترك الساحة لمن بدت البغضاء من كلامه وصدره يحتوي الكثير من الحقد على البلد وعلى شعبها ومن ثأره الظاهر في عينيه لمبارك مثله الأعلى وباقي حزبه المقربين ... على الشعب بجميع تياراته وطوائفه أن يقف ضد الظلم مع هذا الضد سواء كان موسي أو حمدين أو أبو الفتوح الجميع أقرب للشعب من المتاجرين فيه وفي مبادئه ... والوعي هنا يتحتم على الجميع دون الدخول في معمعة الجدل التي لا تسمن ولا تغني ويظل فقط جدلاً عقيماً لا فائدة فيه ... ومن إخواننا العرب الكثير والكثير من يشد على يد الشعب في ذلك فلا مكان للحقد على الإسلام ولا الإسلاميين ولا وقت للحرص على تهميشهم وإقصائهم وإبعادهم فالأمر أكبر من ذلك فهم ينصحون لأنهم لا يملكون غير ذللاك أما من له رأي آخر فالأولى أن يحتفظ به لنفسه لأن رأيه لا يمثل شئ إذ أنه ليس له صوت يؤدي به وليس له حشد يحرضهم ...... لذلك الأولى أن نحرص على سلامة بلادنا والتحليق بعيداً عن الأمور السيئة والسلبية التي تحوطنا من كل اتجاه وكفانا مرجفون بلادنا .... والله المستعان

اسماعيل الناطور
05-28-2012, 09:11 PM
في بلاد العميان ... (http://www.almolltaqa.com/vb/showthread.php?97663-في-بلاد-العميان-...) وإثناء طابور الإستعراض (http://www.almolltaqa.com/vb/showthread.php?100982-طابور-الإستعراض) أحد مشاهد الكوميديـا الرئاسيـه (http://www.almolltaqa.com/vb/showthread.php?100899-الكوميديـا-الرئاسيـه) ظهر الدجال المنتظر (http://www.almolltaqa.com/vb/showthread.php?101485-الدجال-المنتظر) مرتديا وقار رئيس على واحدة ونص (http://www.almolltaqa.com/vb/showthread.php?98651-رئيس-على-واحدة-ونص) فسقط القوم و لبوا نـــداء الدمــــاء (http://www.almolltaqa.com/vb/showthread.php?101583-لبوا-نـــداء-الدمــــاء)

أبو صالح
05-29-2012, 05:26 AM
عصابات بشار تذبح على الهواء
http://wata1.com/vb/showthread.php?t=17332 (http://wata1.com/vb/showthread.php?t=17332)

لحضرة الأخ الذي يسمي نفسه أبو صالح وأتمنى أن يكون عنده البعض من الصلاح
صهيب عبد الرحمن السميط
لا تأخذ نك الظنون أن وفيق رجب سكت عن مهاتراتك ثلاثة أيام عن عبث
وإنما انتظرت الأستاذ ياسر طويش للإستجابة لما طلبت منه ولكنه يغط في نوم عميق
وأجد له العذر في ذلك
تعال ياحضرة الأخ المفكر لأعرفك من الغبي والجاهل والدنيء
ذلك من باع آخرته بدنياه كما فعلتَ
ذلك الديوث الذي لا يغار على عرضه كما أثبت عنك الحاج لطفي الياسيني
ذلك المرتد عن دينه والمنقلب على أهله كا أثبتته الوثائق من الحاج لطفي الياسيني
ذلك الذي يسفه آراء الغير خدمة لتياراته السلفية الداعية للقتل والتفرقة بين أبناء الدين الواحد
إذا كان وفيق رجب يقرأ ما بين السطور مما تكتبه فهل أصبح عندك إلهاً
أنت ذكرت السيد الرئيس بشار الأسد وقلت أنني أؤمن به وباركت لي بجنته
ورددتُ عليك بما كتبتَ فمن ذكر الملك عبد الله والأمير حمد إلا أنت
علماً أنني أجلّهما ولي عليهما عتب وهو كيف قبلا أن يأويا إلى زريبتيهما بهيمة مثلك
ويعلفانها كالبهائم المعلوفة للمُدى بالرغم من هزالتها
لو أفاق الأستاذ ياسر طويش من سباته لكفاني عناء الرد عليك وكفاك همّ معرفة حقيقتك



يا وفيق رجب أشكرك على دليل عملي واضح على البهيمية الحيوانية لديك ويبين كيف أنت لا تهمك سوريا ولا يهمك الشعب السوري ولا يهمك حتى بشار الأسد وكل ما يهمك هو الـ أنا الخاصة بك
فلذلك اخترت للرد في هذا الموضوع الذي يتكلم عن مذبحة بهذا الاستهتار وقلّة الأدب والاتهامات البذيئة التي لم يسلم منها حتى ياسر طويش ناهيك عن الدياثة والوضاعة وبقية الردح الذي حوته مداخلتك
فيا أيها الغبي والجاهل وغير المتابع والدليل أنك لم تتابع ما قام به ياسر طويش من حذف لبذاءات لطفي الياسيني كما طلبت أنت في مواضيعك التي نشرتها لتشويه اسمي وسمعتي وأخلاقي عن عمد وقصد بافتراءات وأكاذيب والتي اعتبرت فيها مداخلات لطفي الياسيني فقط تخدش الحشمة في موضوعك تحت عنوان استفسار في الرابط التالي
http://wata1.com/vb/showthread.php?t=12110 (http://wata1.com/vb/showthread.php?t=12110)
وهذه البذاءات التي أنت طالبت بحذفها الآن اصبحت لدى الجاهل والكاذب والمفتري عن عمد وقصد إلى وثائق وشهادات في تحريف وتدليس واضح عن اصرار وتعمّد ألا سحقا لك ولثقافتك ولأدبك وللـ أنا التي حصرت بها نفسك يا سافل وعديم الشرف والأمانة
هنيئا لك الحقيقة وهنيئا لك الدفاع عن جرائم النظام واسأل الله أن يحشرك مع الظالمين المستبدين والمنحرفين أخلاقيا ممن نشروا أكثر من ألف رابط لأفلام خلاعية التي تعمل على تزييف الدين والأخلاق والوعي زورا وظلما وعدوانا من أجلهم، فما قمت به تأكيدا لعنوان الموضوع من أن عصابات بشار تذبح على الهواء
فهل هناك فرق بين الصدق وبين المصداقية وبين الحقيقة وبين الشعب؟!!!
الذي يصر على ذبحه مثقفي دولة الفلسفة ( مثل وفيق رجب واسماعيل الناطور واعيان القيسي) من أجل الدفاع عن النظام الديمقراطي/الديكتاتوري؟ ولذلك أنا رأيي أنَّ
الشَّعَب يُريد اسْقَاط المُثَّقَّفَ الرَّدَّاحِيِّ السُّوقيِّ المُبتَذَلِ، لماذا؟
http://www.arabelites.com/vb/showthread.php?t=14282 (http://www.arabelites.com/vb/showthread.php?t=14282)
لأنه يجب أن يكون هناك فرق بين لغة الإصلاح وبين لغة الإفساد؟
http://arabelites.com/vb/showthread.php?t=13796 (http://arabelites.com/vb/showthread.php?t=13796)
ما رأيكم دام فضلكم؟

اسماعيل الناطور
05-29-2012, 08:33 AM
في بلاد العميان ... (http://www.almolltaqa.com/vb/showthread.php?97663-في-بلاد-العميان-...) وإثناء طابور الإستعراض (http://www.almolltaqa.com/vb/showthread.php?100982-طابور-الإستعراض) أحد مشاهد الكوميديـا الرئاسيـه (http://www.almolltaqa.com/vb/showthread.php?100899-الكوميديـا-الرئاسيـه) ظهر الدجال المنتظر (http://www.almolltaqa.com/vb/showthread.php?101485-الدجال-المنتظر) مرتديا وقار رئيس على واحدة ونص (http://www.almolltaqa.com/vb/showthread.php?98651-رئيس-على-واحدة-ونص) فسقط القوم و لبوا نـــداء الدمــــاء (http://www.almolltaqa.com/vb/showthread.php?101583-لبوا-نـــداء-الدمــــاء)


نص ينم عن بصيرة ثاقبة، كل شيئ ممكن، في هذا الزمان، تحيتي لألق إبداعك ، أستاذ إسماعيل الناطور.

لن يأتي دجالنا هذه المرة أعورا
بل أعمى تقوده عيون شيطانية

اسماعيل الناطور
05-29-2012, 08:35 AM
الاستاذ اسماعيل



لست أدرى !!! نصك آلمنى .. كما آلمتنى وتؤلمنى أحداث الساعة.. ترى ..أين النهاية وكيف هى ؟؟
تحيتى ومودتى..




الاسلام هو الحل ...ولكن ليس بصيغة الاسلام السياسي , فهذه بضاعة للبيع والشراء
ولكن بصيغة الأخلاق والوفاق والحب ولم شمل الوطن بكل أطيافه وكل أهواءه وكل رغباته ,
وطن يشعر فيه كل مواطن إنه لا غالب ولا مغلوب

أبو صالح
05-29-2012, 08:40 AM
ثورة الحمير بقلم/ اسماعيل الناطور

الاسلام هو الحل ...ولكن ليس بصيغة الاسلام السياسي , فهذه بضاعة للبيع والشراء
ولكن بصيغة الأخلاق والوفاق والحب ولم شمل الوطن بكل أطيافه وكل أهواءه وكل رغباته ,

وطن يشعر فيه كل مواطن إنه لا غالب ولا مغلوب

ما هذا التهريج عن أي اسلام تتكلم وأنت تقول مثل شفيق والصهيونية لا دين في السياسة؟
رئيس على واحدة ونص بقلم اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=14536 (http://wata1.com/vb/showthread.php?t=14536)
هناك شعرة ما بين الأدب الساخر وما بين التهريج والمسخرة بالتأكيد لن يستطيع الانتباه لها من لديه ضبابية لغوية، فكيف الحال فيمن يعاني من جهل لغوي كما هو حال غالبية مثقفي دولة الفلسفة
تهريج في تهريج ولذلك لن تخرج من الموضوع إلاّ بتهريج
حيث قالوا كذلك أنَّ الأعور بين العميان ملك
فكيف بالببغاء بين الهبل إذن؟
ما أروع حكمة العرب حين قالت من مدح نفسه ذمّها
عجبي خصوصا عندما يصدر ذلك ممن يمجّد الرمز أو الأخ القائد أو الأمير أو الملك أو الرئيس أو جمال عبدالناصر أو بشار الأسد

هناك تفاصيل كثيرة لتوضيح الفرق ما بين المقاوم وما بين البلطَجَي أو الشَّبَّيح لمن يرغب يجده في الرابط التالي
http://arabelites.com/vb/showthread.php?t=13845 (http://arabelites.com/vb/showthread.php?t=13845)
ما رأيكم دام فضلكم؟

اسماعيل الناطور
05-29-2012, 01:43 PM
لا انتخابات نزيه لنظام جديد في ظل حكم النظام السابق .. هناك نظام فاسد لا يقل شراسة عن مثيله في سوريا وليبيا واليمن لكنه حاول أن يهادن الثورة وأن يميل مع التيار ويلعب معها لعبة الديموقراطية حتى يستطيع ان ينقض عليها ويجهضها أراد أن يكتسب الشرعيه عن طريق صناديق الانتخابات واللجنة العليا ولو أراد جمال مبارك ان يترشح او مبارك نفسه لحصل على عشرين مليون صوت أو اكثر حتى اذا ما ثار الشعب مرة أخرى خرج عليهم العسكر وردعوهم بالقوة بدعوى حماية الشرعية..!!

وأصبحت تفكر بعقلية المؤامرة
والتي كنت تقاتلنا عليها في مكان آخر
وهذا يفيد إننا كنا على حق من البداية
فالمؤامرة متواجده والمهم من يقرأها جيدا ولا يقرأها ليفسر ما يعجز عن تفسيره
الانتخابات المصرية هي كأي إنتخابات في هذا العالم
المال+ المال+ المال+المال
ومن يملك المال يصبح رئيسا
فأين محمد مرسي
من محمد سليم العوا
مرسي الذي لم يقدم نفسه للترشيح بل أن هناك من أمره ينجح بخمسة مليون
والرجل المفكر صاحب التاريخ في الدين والأخلاق يرسب بربع مليون
يا دكتور ...لا تكلمني عن المال الانتخابي
فمن أراد ووافق على أحكام اللعبة
فليستمر إلى نهايتها
ولا يولول عند الفشل
لو كانت الثورة صادقة لقدمت مرشح واحد وحصل على عشرين مليون وترك الخمسة لشفيق
لو كان التيار الديني صادقا لقدم مرشح واحد وحصل على عشرة مليون والتي حصل عليها مرسي وابو الفتوح وترك الخمسة لشفيق
لكن يا دكتور الله أراد أن يكشف الزيف والخداع والكذب وفضح الله كل منافق ودجال
وأنا مع شفيق طالما أن العوا لم تقدموه وقدمتم عليه أجير لمرشد

أبو صالح
05-29-2012, 02:09 PM
ثورة الحمير بقلم/ اسماعيل الناطور
وأصبحت تفكر بعقلية المؤامرة

والتي كنت تقاتلنا عليها في مكان آخر
وهذا يفيد إننا كنا على حق من البداية
فالمؤامرة متواجده والمهم من يقرأها جيدا ولا يقرأها ليفسر ما يعجز عن تفسيره
الانتخابات المصرية هي كأي إنتخابات في هذا العالم
المال+ المال+ المال+المال
ومن يملك المال يصبح رئيسا
فأين محمد مرسي
من محمد سليم العوا
مرسي الذي لم يقدم نفسه للترشيح بل أن هناك من أمره ينجح بخمسة مليون
والرجل المفكر صاحب التاريخ في الدين والأخلاق يرسب بربع مليون
يا دكتور ...لا تكلمني عن المال الانتخابي
فمن أراد ووافق على أحكام اللعبة
فليستمر إلى نهايتها
ولا يولول عند الفشل
لو كانت الثورة صادقة لقدمت مرشح واحد وحصل على عشرين مليون وترك الخمسة لشفيق
لو كان التيار الديني صادقا لقدم مرشح واحد وحصل على عشرة مليون والتي حصل عليها مرسي وابو الفتوح وترك الخمسة لشفيق
لكن يا دكتور الله أراد أن يكشف الزيف والخداع والكذب وفضح الله كل منافق ودجال

وأنا مع شفيق طالما أن العوا لم تقدموه وقدمتم عليه أجير لمرشد


إن كان هناك من يولول ويردح لتشويه صورة كل من يطالب بأي شيء أخلاقي من انتفاضات أدوات العولمة فهو أنت يا اسماعيل الناطور ومحمد شعبان الموجي وعبدالرحيم وغيركم
إن كان هناك من يفتعل المؤامرات في كل ما يتعلق بانتفاضات أدوات العولمة فهو أنت يا اسماعيل الناطور فيما كنت تقتبسه مما ينشره د. توفيق عكاشة كالببغاء
أنت تعترف الآن بأن أحمد شفيق استخدم المال ثم المال ثم المال وهذا كلامك أنت
ولكن بالنسبة للجانب الآخر لا يوجد أي اثبات أنّه استخدم المال
بل أنت اعتبرته أجير لمرشد أي أنّه حتى لم يطالب بالسلطة أو الكرسي لنفسه كما هو حال سليم العوا أو أحمد شفيق وهذه تحسب لمحمد مرسي بالذات
محمد مرسي ومن خلفه تيار كامل كما هو حال حازم أبو اسماعيل قبله قدم منهاج ليتعاقد معه الشعب على تنفيذه مكتوب وعلى ضوء ذلك يستطيع محاسبته عليه أن قصّر
ما الذي قدمه أحمد شفيق غير التعهد بعدم تحكيم شرع الله وأن يحافظ على علاقاته مع الكيان الصهيوني ومع كل ذلك تدافع عنه أنت ومحمد حسنين هيكل، والذي هو وجمال عبدالناصر عرابي معاهدة روجرز والتي كانت بداية مسيرة الخيانة هذا هو مفهومكم الحقيقي للوطنية أن تكون خائن للأمة والعمل بكل امكانياتك لتشويه كل من يحاول كسر حدود سايكس وبيكو التي عمل على تثبيتها جمال عبدالناصر ومحمد حسنين هيكل داخل عقولنا وليس فقط على الأرض، الله يخزيكم على هذا الفهم الأعوج يا مجرمين

اسماعيل الناطور
05-29-2012, 02:28 PM
الأستاذ أحمد الحارون
للأسف الشديد مداخلتك السابقة بما تحمله من وصاية مرفوضة وأوصاف لاتليق لا بإسلام ولا بثورة تؤكد على أن ثورات الربيع العربي افتقدت إلى الطهارة الثورية والطهارة الأخلاقية والمتمثلة في فرض الوصاية على الشعب ، وفي قلة الأدب في مخاطبة الخصوم واستعمال أبشع الشتائم وأقذع الألفاظ البذيئة والتصبيع باليد .. وفي استبدال أسياد كثر بسيد واحد .. فأصبح هناك أكثر من سيد يسوق جموع الشباب كالقطيع مرة إلى اليمين ومرة إلى الشمال بل ولاأعرف إن كان لديك تليفزيون لترى فيه وتسمع هتافات ثوار التحرير ، وأمهات الشهداء ضد الإخوان وشفيق معا .. فشفيق على حد زعمهم قتل الثوار ، والأخوان قتلوا الثورة ، وليتك استمعت إلى أم خالد سعيد التي أكدت أنها لايمكن أن تختار الإخوان ولا شفيق .. وليتك استمعت إلى حمدين صباحي وأبو الفتوح وهما يرفضان تماما تأييد الإخوان .. رغم كثرة الادعاءات .. كما يبدو أنك لم تسمع أن قطاعا كبيرا من السلفيين رفضوا كذلك تأييد الإخوان وفضلوا عليه أبو الفتوح المنشق عنهم .. فلا داعي للتشبث بالثورة فالإخوان لم تكن في يوم من الأيام حركة ثورية .. بل هي حركة إصلاحية .. والثوار الآن يلعنون شفيق ويلعنون الإخوان سواء بسواء .. والنتن الحقيقي هو من يساق كالخراف يمنة ويسرة دون وعي ودون إرادة حقيقة .. وكما قيل الطريق إلى جهنم مفروش بالنوايا الحسنة .
الثورة الحقيقة هي ثورة القيم والمبادىء .. هي تحرير الناس من عبودية الناس دون تمييز بين عبودية مبارك وعبودية المرشد .. وللأسف الشديد هذه ثورة بلاأخلاق ولا قيم .. وإنما هي ثورة شعارات فارغة لاأكثر ولاأقل
وللأسف الشديد هذه ثورة بلاأخلاق ولا قيم .. وإنما هي ثورة شعارات فارغة لاأكثر ولاأقل

أبو صالح
05-29-2012, 02:42 PM
ثورة الحمير بقلم/اسماعيل الناطور
وللأسف الشديد هذه ثورة بلاأخلاق ولا قيم .. وإنما هي ثورة شعارات فارغة لاأكثر ولاأقل

ما هذا الجبن والخبث في الاحتماء بما ذكره محمد شعبان الموجي ومع ذلك خسئت يا صعلوك أنت ومحمد شعبان الموجي الدجّال والنصّاب في كيفية ادارته للموقع من خلال الأشباح، وكل من يحاول تشويه صورة انتفاضات أدوات العولمة من أجل الجهة الأمنية أو الإعلامية التي يتبعها من النظام،
فهل أنت لديك أخلاق أو أي قيم يا اسماعيل الناطور أم محمد شعبان الموجي أم جمال عبدالناصر أم محمد حسنين هيكل
الأخلاق تظهر واضحة في الممارسة العملية يا من أفعالك الخسيسة والدنيئة لا حدود إلى دنائتها إن كان أنت أو محمد شعبان الموجي
الله يخزيكم على تعدّد الوجوه والنفاق الذي يصر كل منكما على أن يبقينا نتعامل به
أنت يا اسماعيل الناطور ومحمد شعبان الموجي وبقية الشلّة من اصحاب الصلاحيات الإدارية تحاربون الأخلاق علنا والأنكى أنكم تعملون على تشويه كل من يطالب بالالتزام بها عن عمد واصرار وترصد من خلال الممارسة العملية
وأفضل دليل على ذلك بالإضافة إلى هذا الموضوع بعنوانه الحيواني ما قمت به فيما نشرته من محتوى حشراتي تحت العنوان والرابط التالي
ابو صالح بقلم/ اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=17337 (http://wata1.com/vb/showthread.php?t=17337)
وإجرامكم وخستكم وعدم المروءة عندكم ودناءة حقارتكم تظهر واضحة في كيفية استغلال الصلاحيات الإدارية لمنع الطرف الآخر من الرد يا سفلة، الله يخزيكم يا مجرمين
أنتم خريجي مدرسة واحدة ألا وهي الثورة الفرنسية والتي هي من طالبت بعمل كيان للصهيونية في فلسطين
ولذلك أنا رأيي أنَّ
الشَّعَب يُريد اسْقَاط المُثَّقَّفَ الرَّدَّاحِيِّ السُّوقيِّ المُبتَذَلِ، لماذا؟
http://www.arabelites.com/vb/showthread.php?t=14282 (http://www.arabelites.com/vb/showthread.php?t=14282)
لأنه يجب أن يكون هناك فرق بين لغة الإصلاح وبين لغة الإفساد؟
http://www.arabelites.com/vb/showthread.php?t=13796 (http://www.arabelites.com/vb/showthread.php?t=13796)
ما رأيكم دام فضلكم؟

أبو صالح
05-30-2012, 05:30 AM
ابو صالح بقلم/ اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=17337 (http://wata1.com/vb/showthread.php?t=17337)
هذا الموضوع لإسماعيل الناطور كممثل عن ثقافة الـ أنا من وجهة نظري، وهو مثال عملي يوضح مثقف دولة الفلسفة واساليبه في تزييف الوعي بخبث لتشويه المقاومة أو كل من يمثل ثقافة الـ نحن عن عمد وقصد وترصد.
كنت أريد ترك هذا الأمر لبصيرة القارئ , وما دمت سألت ...فلا بد من الإجابة
وجود هذا البقه ( اليهودي الماسوني ) أصبح يفيد أكثر لموضوعنا , فهو يقدم لنا خدمة قد لا يعلمها هو , لأن الحاقد يأكل نفسه , والمفيد لنا هنا أن يقدم نفسه بهذه الصورة الغبية بدلا أن نقوم ونتعب أنفسنا في شرح الكثير من الحمير والأغبياء والذين جاءوا ليسخروا من وعينا ....فسخرنا منهم ووضعناهم حيت تري , وقدمنا قضيتنا من خلال غباء الخصم , وعندما ننتهي منه , سنشطب الفائض من الزبالة والتكرار
أشكر ياسر طويش أنّه جعل المساواة اساس قوانين اللعبة في هذا الموضوع أخيرا
حتى يتعرف الجميع من هو أبو صالح ومن هو محمد شعبان الموجي أو وائل يسري (يسري راغب شراب) أو اسماعيل الناطور الذي افتتح هذا الموضوع لتشويه صورته وسمعته بإسلوب يوضح مفاهيمه الأخلاقية على حقيقتها في سرقة المواضيع وإعادة نشرها هنا عن الحشرات على سبيل المثال بدون حتى ذكر اسم كاتبها أو من أين سرقها؟!!!
ويوضح مقدار جبنه وخسته في استغلال الصلاحيات الإدارية التي كانت لديه لكي يحذف أقل من عشرة مداخلات والتي أتحداه هو ومحمد شعبان الموجي ووائل يسري (يسري راغب شراب) أن يفنّد أو يشكك في مصداقية ما ورد بها؟!!
ناهيك عن غلق الموضوع ومن ثم إعادة نشر المداخلات كما هو حال المداخلة المقتبسة لكتابة كل ما يحلو له لتشويه الصورة والسمعة بطريقة لا علاقة لها بأخلاق المسلمين ولا بمروءة العرب على الإطلاق للتفريق بيننا وبين الملل والأديان الأخرى .
الشيء المفيد فيها أنّها توضح لنا الممارسات الصهيونية والماسونية لخدمة شعب الله المختار أو النخب الحاكمة أو خلاصة العقل على حقيقتها حيث من الواضح أنّه بسبب نظرية المؤامرة فهو جندي في الطابور الخامس لخدمة الماسونية والصهيونية وأمريكا وجعل من قياداتها فراعنة وأساطير يوضح مستوى الدجل والنصب لمفهوم الثقافة والمثقف لأمثاله من اتباع جمال عبدالناصر ومحمد حسنين هيكل وبشار الأسد ممن يظن أنَّ هناك انسان معصوم من الخطأ ويجب أن يكون فوق النَّقد.
وفي الجانب الآخر توضح موقفي حيث ما الخطأ إن أتيت على ذكر اسماء طالما كنت أخاف الله في أن يكون هناك مصداقيّة فيما أطرحه.
أنا من وجهة نظري أنَّ:
-الإشكالية هي في ذكر معلومات لا يوجد فيها شيء من المصداقية كما وردت في الموضوع التالي باسلوب ولا تقربوا الصلاة دون تكملة الآية بخبث من قبل اسماعيل الناطور ومن دخل للتهليل والتطبيل والتزمير له في تنسيق واضح للأدوار
ثورة الحمير بقلم/اسماعيل الناطور
-الإشكالية هي في ذكر معلومات لا يوجد فيها شيء من المصداقية كما وردت في الموضوع التالي باسلوب ولا تقربوا الصلاة دون تكملة الآية بخبث من قبل عبدالرحيم محمود ومن دخل للتهليل والتطبيل والتزمير له في تنسيق واضح للأدوار
ثورات أم مهازل بقلم/ عبد الرحيم محمود
http://almolltaqa.com/ib/showthread.php?97395-ثورات-أم-مهازل-عبد-الرحيم-محمود (http://almolltaqa.com/ib/showthread.php?97395-ثورات-أم-مهازل-عبد-الرحيم-محمود)
-الإشكاليّة في الاصطياد في المياه العكرة من قبل الشيعة والصوفيّة والعلمانية والحداثية للهجوم والتجريح بتيار فكري كامل وبدون حتى ذكر مصدر من قالها وأين قالها كما قام بذلك محمد شعبان الموجي ومن دخل للتهليل والتطبيل والتزمير له في الرابط التالي
هل يرى الإخوان أن نار شفيق ولا جنة أبو الفتوح ؟؟؟؟ بقلم/ محمد شعبان الموجي
http://almolltaqa.com/ib/showthread.php?97470-هل-يرى-الإخوان-أن-نار-شفيق-ولا-جنة-أبو-الفتوح-؟؟؟؟ (http://almolltaqa.com/ib/showthread.php?97470-هل-يرى-الإخوان-أن-نار-شفيق-ولا-جنة-أبو-الفتوح-؟؟؟؟)
هؤلاء كيف يمكن تجاوز مصائبهم من قبل الأمة؟ خصوصا وأنَّهم يصرون على اشعال الحرائق بحجة أن لديهم وقت فائض ويريد أن يتسلى فيبحث عن موضوع يفضفض فيه بالضحك على الآخرين
فمن هو الدجال أو من يصنع الفرعون أو الإسطورة؟
http://arabelites.com/vb/showthread.php?t=14019 (http://arabelites.com/vb/showthread.php?t=14019)
(http://arabelites.com/vb/showthread.php?t=14019)ما رأيكم دام فضلكم؟

اسماعيل الناطور
06-04-2012, 12:03 PM
شريف منصور المدير الاقليمى لمؤسسة فريدم هاوس
http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/206711_114879595259157_110908425656274_130710_6548 061_n.jpg (http://www.facebook.com/photo.php?pid=130711&id=110908425656274)
http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/197069_114880065259110_110908425656274_130713_3732 61_n.jpg (http://www.facebook.com/photo.php?pid=130714&id=110908425656274)
شريف منصور والبرادعى


ألقت سلطات مطار القاهرة مساء، اليوم الأحد، القبض علي مسئول بمنظمة فريدوم هاوس (بيت الحرية) الأمريكية لدى عودته إلى مصر قادمًا من ميونيخ لتورطه في منظمات تمويل المجتمع المدني في مصر.

وصرحت مصادر مسئولة بالمطار، بأنه في أثناء إنهاء إجراءات جوازات ركاب الطائرة المصرية القادمة من ميونيخ تبين أن راكبًا مصريًا يدعى شريف أحمد صبحي منصور "32 عامًا"، وهو مشرف مكتب مصر وشمال إفريقيا والشرق الأوسط في منظمة فريدوم هاوس تبين وجوده اسمه علي قوائم ترقب الوصول والضبط لتورطه في قضية تمويل منظمات المجتمع المدني والمتهم فيها 43 شخصًا من المصريين والأجانب.

يذكر أن شريف هو نجل الدكتور أحمد صبحي منصور، الأستاذ الأزهري، الذي أثار ضجة خلال الأعوام الماضية بسبب إنكاره للسنة النبوية ويقيم في الولايات المتحدة مع أسرته.

كما قام شريف بالإشراف علي تدريب 15 مصريًا في منتجع " باليتش " في صربيا عام 2009 علي " تفكيك النظام، وكيفية التخلص منه " وذلك في إطار تشكيل جيل جديد من نشطاء العالم الثالث، ليتمكنوا- حسب البرنامج الذى تموله مؤسسة فريدوم هاوس بالتعاون مع بعض المنظمات المحلية- من خلق جيل جديد لدعاة الديمقراطية، إلى النضال السلمى ضد السلطة.

يذكر أنه تم في مطلع العام الحالي احتجاز 43 متهمًا من بينهم 19 أمريكيًا وبريطانيون على خلفية ما يُعرف بقضية "التمويل الأجنبي للجمعيات" ما أثار توتراً حاداً في العلاقات بين مصر والولايات المتحدة.

أبو صالح
06-04-2012, 01:40 PM
زيارة إلى فكر (قلم) بقلم / اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=5067 (http://wata1.com/vb/showthread.php?t=5067)
[/font]
الشخصية الوقحة
هي شخصية تعتمد الإستفزاز السلبي في تعاملها مع الآخر
بمعنى إنها تحاول إيذاء المشاعر حين التعامل بدلا من الإستفزاز الإيجابي والذي يعتمد على الإستفزاز العقلي
فإن تطور أمرها وترافق مع ضعفها للوصول إلى ما تريد
فإن ضعفها إمام الفشل يتحول إلى الكذب السافر لدرجة إنها تحول كل إسقاطاتها النفسية على الخصم
فتجد إنها تفعل فعل الفراشة التي تحوم حول النار حتى تحرق نفسها


فتخسر المزيد في كل محاولة للنجاح


يا اسماعيل الناطور أن تأت على اللون الأبيض وتدعي زورا وظلما وعدوانا أنّه لون أسود وتصدر فتواك بخبث على اللون الأسود، هذا لن يجعل اللون الأبيض أصبح أسودا ولا يجعل لفتواك أي شيء من الصحة، وسيمر هذا التدليس والتزوير الخبيث على من أصيب بعمى الألوان وهؤلاء لا يهموني في شيء على الإطلاق، كما لا يهمني كل خائن لمدرسة الصمود والتحدي مثلك يا اسماعيل الناطور والشاهد على خيانتك هو محمد شعبان الموجي

من وجهة نظري أنَّ الشخصية الوقحة هي الشخصية التي تتعمد الكذب وتكرار ترديد الأكاذيب لتزييف الوعي عن عمد وقصد بلا حياء ولا خجل
وأظن اصرار اسماعيل الناطور على الكذب والسرقة لنصوص الآخرين ومداخلاتهم بلا حياء ولا خجل وبمثل هذا المستوى السوقي المبتذل يبين مستواه الردّاحي ليس إلّا
السؤال المنطقي والموضوعي هل هذه أول مرة يعملها أم هي عادة قام فيها بتكرار نفس الاسطوانة المشروخة مع حكيم عباس وعبدالرحمن السليمان ومحمد رندي ود.عبدالحميد مظهر وغيرهم؟
وهل ترك لأولاد الشوارع من الرداحين والرداحات أي مجال لمنافسته فيه خصوصا وأنها الأكاذيب والافتراءات في ردحه وصلت إلى العرض والشرف من أهل بيت كل من اختلف معهم على أتفه الاسباب والإنقلاب 180 درجة في رأيه من أقصى المدح إلى أقصى الذم؟
إن كان في هذا الموضوع أعلاه وكيفية استغلال الصلاحيات الإدارية فيه إن كان من ناحية المنع أو التزوير في محتويات المداخلات بخسة ودناءة منقطعة النظير تنم عن حقد أسود تماما كما فعل فيما نشره تحت العنوان والرابط التالي
ابو صالح بقلم/ اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=17337 (http://wata1.com/vb/showthread.php?t=17337)
هذا الموضوع لإسماعيل الناطور كممثل عن ثقافة الـ أنا من وجهة نظري، وهو مثال عملي يوضح مثقف دولة الفلسفة واساليبه في تزييف الوعي بخبث لتشويه المقاومة أو كل من يمثل ثقافة الـ نحن عن عمد وقصد وترصد.
ألا سحقا لمثل هذه الثقافة القومية التي تعمل على تثبيت حدود سايكس وبيكو داخل عقولنا لتفريق العرب والمسلمين وليس فقط على أرض الواقع والتي عمل على نشرها جمال عبدالناصر ومحمد حسنين هيكل وحافظ الأسد عرّابي خيانة فلسطين بالعملية الاستسلامية التخاذلية التي أضاعت 80 بالمئة من فلسطين والأنكى أن سبب حجتهم هو تحرير فلسطين ويأتي اسماعيل الناطور يعمل على تمرير هذا الغش والتدليس بحجة أنَّه قمة الوطنية والقومية زورا وظلما وعدوانا؟!!!
ومن استيقظ وأفاق من هذه المهزلة السخيفة التي ضحكوا علينا بها طوال نصف القرن الماضي وبدأ يعمل على كشف هذه الخديعة فهو ماسوني وصهيوني كما تشاهدون فيما يحرص على القيام به تجاه كل من شارك في انتفاضات أدوات العولمة في عام 2011؟!!! هل رأيتم عهر وسفالة أكثر من ذلك؟!!!
ما رأيكم دام فضلكم؟

أبو صالح
06-04-2012, 02:10 PM
ثورة الحمير بقلم/اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=9044&page=110 (http://wata1.com/vb/showthread.php?t=9044&page=110)
وللأسف الشديد هذه ثورة بلاأخلاق ولا قيم .. وإنما هي ثورة شعارات فارغة لاأكثر ولاأقل

ما هذا الجبن والخبث في الاحتماء بما ذكره محمد شعبان الموجي ومع ذلك خسئت يا صعلوك أنت ومحمد شعبان الموجي الدجّال والنصّاب في كيفية ادارته للموقع من خلال الأشباح، وكل من يحاول تشويه صورة انتفاضات أدوات العولمة من أجل الجهة الأمنية أو الإعلامية التي يتبعها من النظام،
فهل أنت لديك أخلاق أو أي قيم يا اسماعيل الناطور أم محمد شعبان الموجي أم جمال عبدالناصر أم محمد حسنين هيكل
الأخلاق تظهر واضحة في الممارسة العملية يا من أفعالك الخسيسة والدنيئة لا حدود إلى دنائتها إن كان أنت أو محمد شعبان الموجي
الله يخزيكم على تعدّد الوجوه والنفاق الذي يصر كل منكما على أن يبقينا نتعامل به
أنت يا اسماعيل الناطور ومحمد شعبان الموجي وبقية الشلّة من اصحاب الصلاحيات الإدارية تحاربون الأخلاق علنا والأنكى أنكم تعملون على تشويه كل من يطالب بالالتزام بها عن عمد واصرار وترصد من خلال الممارسة العملية
وأفضل دليل على ذلك بالإضافة إلى هذا الموضوع بعنوانه الحيواني ما قمت به فيما نشرته من محتوى حشراتي تحت العنوان والرابط التالي
ابو صالح بقلم/ اسماعيل الناطور
http://wata1.com/vb/showthread.php?t=17337 (http://wata1.com/vb/showthread.php?t=17337)
وإجرامكم وخستكم وعدم المروءة عندكم ودناءة حقارتكم تظهر واضحة في كيفية استغلال الصلاحيات الإدارية لمنع الطرف الآخر من الرد يا سفلة، الله يخزيكم يا مجرمين
أنتم خريجي مدرسة واحدة ألا وهي الثورة الفرنسية والتي هي من طالبت بعمل كيان للصهيونية في فلسطين
ولذلك أنا رأيي أنَّ
الشَّعَب يُريد اسْقَاط المُثَّقَّفَ الرَّدَّاحِيِّ السُّوقيِّ المُبتَذَلِ، لماذا؟
http://www.arabelites.com/vb/showthread.php?t=14282 (http://www.arabelites.com/vb/showthread.php?t=14282)
لأنه يجب أن يكون هناك فرق بين لغة الإصلاح وبين لغة الإفساد؟
http://www.arabelites.com/vb/showthread.php?t=13796 (http://www.arabelites.com/vb/showthread.php?t=13796)
ما رأيكم دام فضلكم؟

اسماعيل الناطور
06-05-2012, 08:53 AM
وعادت ريمه لمطالبها القديمة
ونعود بكم إلى مشاركة بتاريخ 10-6-2011م ...
قبل سنة كاملة

مطالب التحالف الاميركي المصري 3) annulling the current constitution and its amendments3) إلغاء الدستور الحالي وتعديلاته 4) establishment of a 5-member transitional presidential council comprised of one military and four civilians, none of whom may run in the first upcoming presidential elections4) إنشاء مجلس رئاسي انتقالي يتألف من خمسة أعضاء واحد من العسكريين وأربعة من مدنيين ، على إن لا يتقدم أي منهم في أول الانتخابات الرئاسية المقبلة المشروع لم يكتمل بعد.....إنتظروا جمعة/ات الغضب

هذه الثورات الملونة لم يطلقوا عليها لفظ ملونة إلا لإنها تتكون من أطياف متعدده متنافرة وتحمل أفكار متعارضة ويتم جمعها بذكاء حول هدف إنساني واحد ومشترك للكل رغم تناقضهم , هدف مشترك ((((إسقاط نظام الفساد ))))
ولكن مصيبة هذا النوع من الثورات ليس إنجاز هذا الهدف المشترك
المصيبة في
كيف لهم أن يتفقوا بعد ذلك على إنشاء نظام جديد لم يتفقوا عليه ولم يتصوروه سلفا فكل منهم كان يعتبر نفسه القائد؟
لذلك فإن معركة الدستور ومعركة عودة النظام هي نصف الثورة المنتظر والمخيف
ومخيف
لأن من قالوا سلمية لإحراج النظام الفاسد ومنعه من إستخدام قوته لن يقولوا سلمية عندما تبدأ لعبة الكراسي والأجندات والافكار والطوائف والأديان والأحزاب والتناقضات
إن المعركة القادمة مخيفة إذا إتخذت مسار فتنة قادمة
لذلك يجب أن ينتبه لها أشراف الثورة وينتبه لها الشعب الذي لولا تضحيته لما إنتصرت ثورة
فهل تعتقدون أن شهيدا واحدا سقط من المنظمين ؟!!!
أعتقد أن الشهداء كلهم من شباب أحرار خرجوا فعلا من دون تنظيم , فهكذا الحال في كل الثورات
يجب أن تتم عملية الفرز بين الجمع الذي شارك في عملية إسقاط النظام ودراسة كل الأطياف تاريخا وحاضرا وافكارا وخلفيات
لذلك إذا كنت تريد المصداقية إبحث عن قرينة أو دليل
أما إذا كنت تريد عكس ذلك فإستمر في التكذيب بدون قرينة أو دليل